SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021975 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021975
Domain Number 1 Region: 120-226
Classification Level Classification E-value
Superfamily Fibronectin type III 2.11e-32
Family Fibronectin type III 0.00000054
Further Details:      
 
Domain Number 2 Region: 26-119
Classification Level Classification E-value
Superfamily Immunoglobulin 1.1e-30
Family C2 set domains 0.00000409
Further Details:      
 
Domain Number 3 Region: 434-618
Classification Level Classification E-value
Superfamily Fibronectin type III 7.72e-20
Family Fibronectin type III 0.0036
Further Details:      
 
Domain Number 4 Region: 229-328
Classification Level Classification E-value
Superfamily Fibronectin type III 3.44e-17
Family Fibronectin type III 0.00000103
Further Details:      
 
Domain Number 5 Region: 322-424
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000305
Family Fibronectin type III 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021975   Gene: ENSGGOG00000013573   Transcript: ENSGGOT00000026199
Sequence length 836
Comment pep:known_by_projection chromosome:gorGor3.1:1:37715604:37730067:-1 gene:ENSGGOG00000013573 transcript:ENSGGOT00000026199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARLGTCSLTWAAVIILLLPGSLEECGHISVSAPIVHLGDPITASCIIKQNCSHLDPEPQ
ILWRLGAELQPGGRQQRLSDGTQESIITLPHLNHTQAFLSCCLNWGNSLQILDQVELRAG
YPPAIPHNLSCLMNLTTSSLICQWEPGPETHLPTSFTLKSFKSRGNCQTQGDSILDCVPK
DGQSHCSIPRRHLLLYQNMGIWVQAENALGTSTSPQLCLDPMDVVKLEPPMLRTMDPSPE
AAPPQAGCLQLCWEPWQPGLHINQKCELRHKPQRGEASWALVGPLPLEALQYELCGLLPA
TAYTLQIRCIRWPLPGHWSDWSPSLELRTTEQAPTVRLDTWWRQRQLDPRTVQLFWKPVP
LEEDSGRIQGYVVSWRPSGQAGAILPLCNTTELGCTFHLPSEAQEVALVAYNSAGTSRPT
PVVFSESRGPALTRLHAMARDPHSLWVGWEPPSPWPQGYVIEWGLGSPSASNSNKTWRME
QNGRATGFLLKENIRPFQLYEITVTPLYQDTMGPSQHVYAYSQEMAPSHAPELHLKHIGK
TWAQLEWVPEPPELGKSPLTHYTIFWTNAQNQSFSAILNASSRGFVLHGLEPASLYHIHL
MAASQAGATNSTVLTLMTLTPEGSELHIILGLFSLLLLLTCLCGTAWLCCSPSRKNPLWP
SVPDPAHSSLGSWVPTVMEEDAFQLPGLGTPPITKLTVLEEDEKKPVPWESHNSSETCGL
PTLVQTYVLQGDPRAASTQPQSQSGTSDQVLYGQLLGSPTSPGPGHYLRCDSTQPLLAGL
TPSPKSYENLWFQASPLGTLVTPAPSQEDDCVFGPLLNFPLLQGIRVHGMEALGSF
Download sequence
Identical sequences G3S1M9
XP_018871002.1.27298 ENSGGOP00000021975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]