SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021980 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021980
Domain Number 1 Region: 381-409,443-547,669-784
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.44e-54
Family Phosphate binding protein-like 0.0000000965
Further Details:      
 
Domain Number 2 Region: 14-374
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 5.65e-26
Family L-arabinose binding protein-like 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021980   Gene: ENSGGOG00000013433   Transcript: ENSGGOT00000022079
Sequence length 1299
Comment pep:known_by_projection chromosome:gorGor3.1:19:45669908:45718162:1 gene:ENSGGOG00000013433 transcript:ENSGGOT00000022079 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XGGGLGGARPLNVALVFSGPAYAAEAARLGPAVAAAVRSPGLDVRPVALVLNGSDPRSLV
LQLCDLLSGLRVHGVVFEDDSRAPAVAPILDFLSAQTSLPIVAVHGGAALVLTPKEKGST
FLQLGSSTEQQLQVIFEVLEEYDWTSFVAVTTRAPGHRAFLSYIEVLTDGSLVGWEHRGA
LTLDPGAGEAVLSAQLRSVSAQIRLLFCAREEAEPVFRAAEEAGLTGSGYVWFMVGPQLA
GGGGSGAPGEPPLLPGGAPLPAGLFAVRSAGWRDDLARRVAAGVAVVARGAQALLRDYGF
LPELGHDCRAQNRTHRGESLHRYFMNITWDNRDYSFNEDGFLVNPSLVVISLTRDRTWEV
VGSWEQQTLRLKYPLWSRYGRFLQPVDDTQHLTVATLEERPFVIVEPADPISGTCIRDSV
PCRSQLNRTHSPPPDAPRPEKRCCKGFCIDILKRLAHTIGFSYDLYLVTNGKHGKKIDGV
WNGMIGEVFYQRADMAIGSLTINEERSEIVDFSVPFVETGISVMVARSNGTVSPSAFLEP
YSPAVWVMMFVMCLTVVAVTVFIFEYLSPVGYNRSLATGKRPGGSTFTIGKSIWLLWALV
FNNSVPVENPRGTTSKIMVLVWAFFAVIFLASYTANLAAFMIQEEYVDTVSGLSDRKFQR
PQEQYPPLKFGTVPNGSTEKNIRSNYPDMHSYMVRYNQPRVEEALTQLKAGKLDAFIYDA
AVLNYMARKDEGCKLVTIGSGKVFATTGYGIALHKGSRWKRPIDLALLQFLGDDEIEMLE
RLWLSGICHNDKIEVMSSKLDIDNMAGVFYMLLVAMGLSLLVFAWEHLVYWRLRHCLGPT
HRMDFLLAFSRGMYSCCSAXXXXAAPPPAKPPPPPQPLPSPAYPAPRPAPGPAPFVPRER
ASVDRWRRTKGKGPPGGAGLADGFHRYYGPIEPQGLGLGLGEARAAPRGAAGRPLSPPAA
QPPQKPPPSYFAIVRDKEPAEPPAGAFPGFPSPPAPPAAAATAVGPPLCRLAFEDESPPL
PARWPRSDPESQPLLGPGAGGAGGTGGAGGGAPAAPPPCRAAPPPCPYLDLEPSPSDSED
SESLGGASLGGLEPWWFADFPYPYAERLGPPPGRYWSVDKLGGWRAGSWDYLPPRSGPAA
WHCRHCASLELLPPPRHLSCSHDGLDGGWWAPPPPPWAARPLPRRRARCGCPRSHPHRPR
ASHRTPAAAAPHHHRHRRAAGGWDLPPPAPTSRSLEDLSSCPRAAPARRLTGPSRHARRC
PHAAHWGPPLPTASHRRHRGGDLGTRRGSAHFSSLESEV
Download sequence
Identical sequences ENSGGOP00000021980 ENSGGOP00000021980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]