SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022104 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022104
Domain Number 1 Region: 737-817
Classification Level Classification E-value
Superfamily SH3-domain 6.96e-20
Family SH3-domain 0.00091
Further Details:      
 
Domain Number 2 Region: 1207-1265
Classification Level Classification E-value
Superfamily SH3-domain 2.1e-19
Family SH3-domain 0.001
Further Details:      
 
Domain Number 3 Region: 819-905
Classification Level Classification E-value
Superfamily SH3-domain 2.63e-18
Family SH3-domain 0.00097
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000022104
Domain Number - Region: 175-208
Classification Level Classification E-value
Superfamily Dehydroquinate synthase-like 0.0802
Family Iron-containing alcohol dehydrogenase 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022104   Gene: ENSGGOG00000010457   Transcript: ENSGGOT00000026857
Sequence length 1267
Comment pep:known_by_projection chromosome:gorGor3.1:10:108602265:108799101:-1 gene:ENSGGOG00000010457 transcript:ENSGGOT00000026857 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSECDGGSKAVVNGLALGSNGQDKATADPLRARSISAVKIIPVKTVKNASGLVLPTDMD
PTKICTGKGAVTLRASSSYRETPSSSPASPQETRQHESKPGLEPEPSSADEWRLSSSADA
NGNAQPSSLAAKGYRSVHPNLPSDKSQDATSSIAAQPEVIVVPLYLVNTDRGQEGTARPP
TPLGPLGCVPTIPATASAASPLTFPTLDDFIPPHLQRWPHHSQPARASGSFAPISQTPPS
FSPPPPLVPPAPEDLRRVSEPDLTGAVSSTDSSPLLNEVSSSLIGTDSQAFPPVSKPSSA
YPSTTIVNPTIVLLQHNREQQKRLSSLSDPVSERRVGEQDSAPTQEKPTSPGKAAEKRAK
DDSRRVVKSAQDLSDVSMDEVGIPLRNTERSKDWYKTMFKQIHKLNRDDDSDLYSPRYSF
SEDTKSPLSVPRSKSEMSYIDGEKVVKRSATLPLPARSSSLKSSSESRNDWEPPDKKVDT
RKYRAEPKSIYEYQPGKSSVLTNEKMSRDISPEEIDLKNEPWYKFFSELEFGKPPPKKIW
DYTPGDCSILPREDRKTNLDKDLSLCQTELEADLEKMETLNKAPSANVPQSSAISPTPEI
SSETPGYIYSSNFHAVKRESDGTPGDLTSLENERQIYKSVLEGGDIPLQGLSGLKRPSSS
ASTKDSESPRHFIPADYLESTEEFIRRRHDDKEKLLADQRRLKREQEEADIAARRHTGVI
PTHHQFITNERFGDLLNIDDTAKRKSGSEMRPARAKFDFKAQTLKELPLQKGDIVYIYKQ
IDQNWYEGEHHGRVGIFPRTYIEVPQPLEKAQPKKLTPVQVLEYGEAVAKFNFNGDTQVE
MSFRKGERITLLRQVDENWYEGRIPGTSRQGIFPITYVDVIKRPLVKNPVDYMDLPFSSS
PSRSATASPQFSSHSKLITPAPSSLPHSRRALSPEMHAVTSEWISLTVGVPGRRSLALTP
PLPPLPEASIYNTDHLALSPRASPSLSLSLPHLSWSDRPTPRSVASPLALPSPHKTYSLA
PTSQASLHMNGDGGVHTPSSGIHQDSFLQLPLGSSDSVISQLSDAFSSQSKRQPWREESG
QYERKAERGAGERGPGGPKISKKSCLKPSDVVRCLSTEQRLSDLNTPEESRPGKPLGSAF
PGSEAEQTERHRGGEQAGRKAARRGGSQLSHHSLRAGPDLTESEKSYVQPQAQQRRVTPD
RSQTSQDLFSYQALYSYIPQNDDELELRDGDIVDVMEKCDDGWFVGTSRRTRQFGTFPGN
YVKPLYL
Download sequence
Identical sequences ENSGGOP00000022104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]