SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022121 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022121
Domain Number 1 Region: 468-665
Classification Level Classification E-value
Superfamily Kelch motif 2.09e-62
Family Kelch motif 0.0000107
Further Details:      
 
Domain Number 2 Region: 621-753
Classification Level Classification E-value
Superfamily Kelch motif 1.24e-39
Family Kelch motif 0.0000943
Further Details:      
 
Domain Number 3 Region: 201-315
Classification Level Classification E-value
Superfamily POZ domain 1.57e-32
Family BTB/POZ domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022121   Gene: ENSGGOG00000001643   Transcript: ENSGGOT00000026088
Sequence length 755
Comment pep:known_by_projection chromosome:gorGor3.1:4:39351764:39416771:1 gene:ENSGGOG00000001643 transcript:ENSGGOT00000026088 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNVIYFPLHLFVVYSRAYTSLVLVGCTNLCAVLFARCLDDHLVSLRMSGSRKEFDVKQIL
KIRWRWFGHQASSPNSTVDSQQGEFWNRGQTGANGGRKFLDPCSLQLPLASIGYRRSSQL
DFQNSPSWPMASTSEVPAFEFTAEDCGGAHWLDRPEVDDGTSEEENESDSSSCRTSNSSQ
TLSSCHTMEPCTSDEFFQALNHAEQTFKKMENYLRHKQLCDVILVAGDRRIPAHRLVLSS
VSDYFAAMFTNDVREARQEEIKMEGVEPNSLWSLIQYAYTGRLELKEDNIECLLSTACLL
QLSQVVEACCKFLMKQLHPSNCLGIRSFADAQGCTDLHKVAHNYTMEHFMEVIRNQEFVL
LPASEIAKLLASDDMNIPNEETILNALLTWVRHDLEQRRKDLSKLLAYIRLPLLAPQFLA
DMENNALFQDDIECQKLIMEAMKYHLLPERRPMLQSPRTKPRKSTVGTLFAVGGMDSTKG
ATSIEKYDLRTNMWTPVANMNGRRLQFGVAVLDDKLYVVGGRDGLKTLNTVECYNPKTKT
WSVMPPMSTHRHGLGVAVLEGPMYAVGGHDGWSYLNTVERWDPQARQWNFVATMSTPRST
VGVAVLSGKLYAVGGRDGSSCLKSVECFDPHTNKWTLCAQMSKRRGGVGVTTWNGLLYAI
GGHDAPASNLTSRLSDCVERYDPKTDMWTAVASMSISRDAVGVCLLGDKLYAVGGYDGQA
YLNTVEAYDPQTNEWTQVAPLCLGRAGACVVTVKL
Download sequence
Identical sequences G3QH02
ENSGGOP00000018004 ENSGGOP00000022121 XP_004038607.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]