SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022263 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022263
Domain Number 1 Region: 296-384
Classification Level Classification E-value
Superfamily Immunoglobulin 7.48e-18
Family I set domains 0.019
Further Details:      
 
Domain Number 2 Region: 380-476
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000639
Family I set domains 0.032
Further Details:      
 
Domain Number 3 Region: 6-88
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000333
Family I set domains 0.044
Further Details:      
 
Domain Number 4 Region: 204-298
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000555
Family I set domains 0.027
Further Details:      
 
Domain Number 5 Region: 125-208
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000256
Family C1 set domains (antibody constant domain-like) 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022263   Gene: ENSGGOG00000005038   Transcript: ENSGGOT00000023322
Sequence length 740
Comment pep:known_by_projection chromosome:gorGor3.1:11:124618482:124720905:-1 gene:ENSGGOG00000005038 transcript:ENSGGOT00000023322 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GQVYSFSQQPQDQVVVSGQPVTLLCAIPEYDGFVLWIKDGLALGVGRDLSSYPQYLVVGN
HLSGEHHLKILRAELQDDAVYECQAIQAAIRSRPARLTVLAPGQGPGSLGGPLFSVGRSF
PLINIPCCLSNAQTCASFIFLKKGEVGVQGWAWNKTLLRDGKRESIVSTLFISPGDVENG
QSIVCRATNKAIPGGKETSVTIDIQHPPLVNLSVEPPPPPQPVLEDNVVTFHCSAKANPA
VTQYRWAKRGQIIKEASGEVYRTTVDYTYFSEPVSCEVTNALGSTNLSRTVDVYFGPRMT
TEPQSLLVDLGSDAIFSCAWTGNPSLTIVWMKRGSGVVLSNEKTLTLKSVRQEDAGKYVC
RAVVPRVGAGEREVTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTPPPDRIAWSWKEN
VLESGTSGRYTVETISTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQG
SEMKSGAGLEAESVPMAVIIGVAVGAGVAFLVLMATIVAFCCARSQRNLKGVVSAKNDIR
VEIVHKEPASGREAEEHSTIKQLMMDRGEFQQDSVLKQLEVLKEEEKEFQNLKDPTNGYY
SVNTFKEHHSTPTISLSSCQPDLRPAGKQRVPTGMSFTNIYSTLSGQGRLYDYGQRFVLG
MGSSSIELCEREFQRGSLSDSSSFLDTQCDSSVSSSGKQDGYVQFDKASKASASSSHHSQ
SSSQNSDPSRPLQRRMQTHV
Download sequence
Identical sequences ENSGGOP00000004940 ENSGGOP00000022263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]