SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022275 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022275
Domain Number 1 Region: 662-813
Classification Level Classification E-value
Superfamily C-type lectin-like 2.62e-43
Family C-type lectin domain 0.00000565
Further Details:      
 
Domain Number 2 Region: 151-265
Classification Level Classification E-value
Superfamily C-type lectin-like 2.82e-42
Family Link domain 0.0052
Further Details:      
 
Domain Number 3 Region: 267-360
Classification Level Classification E-value
Superfamily C-type lectin-like 7.42e-31
Family Link domain 0.0063
Further Details:      
 
Domain Number 4 Region: 44-155
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000287
Family V set domains (antibody variable domain-like) 0.048
Further Details:      
 
Domain Number 5 Region: 813-872
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000431
Family Complement control module/SCR domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022275   Gene: ENSGGOG00000026331   Transcript: ENSGGOT00000026504
Sequence length 911
Comment pep:known_by_projection chromosome:gorGor3.1:1:135655529:135673049:1 gene:ENSGGOG00000026331 transcript:ENSGGOT00000026504 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQLFLPLLAALVLAQAPAALADVLEGDSSEDRAFRVRIAGDAPLQGVLGGALTIPCHVH
YLRPPPSRRAVLGSPRVKWTFLSGGREAEVLVARGVRVKVNEAYRFRVALPAYPASLTDV
SLALSELRPNDSGIYRCEVQHGIDDSSDAVEVKVKGVVFLYREGSARYAFSFSGAQEACA
RIGAHIATPEQLYAAYLGGYEQCDAGWLSDQTVXYPIQTPREACYGDMDGFPGVRNYGVV
DPDDLYDVYCYAEDLNGELFLGDPPEKLTLEEARAYCQERGAEIATTGQLYAAWNGGLDH
CSPGWLADGSVRYPIVTPSQRCGGGLPGVKTLFLFPNQTGFPNKHSRFNVYCFRDSAQPS
AIPEASNPASNPASDGLEAIVTVTETLEELQLPQEAIESESRGAIYSIPIMEDGGGGSST
PEDPAEAPRTLLEFETQSMVPPTGFSEEEGKALEEEEKYEDDEEKEEEEEEEEVEDEALW
AWPSELSSPGPEASLPTEPAAQEESLSQAPARAVLQPGASPLPDGESEASRPPRVHGPPT
ETLPTPRERNLASPSPSTLVEAREVGEATGGPELSGVPRGESEETGSSEGAPSLLPATRA
PEGTRELEAPSEDNSGRTAPAGTSVQAQPVLPTDSASRGGVAVVPASGDCVPSPCHNGGT
CLEEEEGVRCLCLPGYGGDLCDVGLRFCNPGWDAFQGACYKHFSTRRSWEEAETQCRMYG
AHLASISTPEEQDFINNRYREYQWIGLNDRTIEGDFLWSDGVPLLYENWNPGQPDSYFLS
GENCVVMVWHDQGQWSDVPCNYHLSYTCKMGLVSCGPPPELPLAQVFGRPRLRYEVDTVL
RYRCREGLAQRNLPLIRCQENGRWEAPQISCVPRRPARALHPEKDPEGRQGRLLGRWKAL
LIPPSSPMPGP
Download sequence
Identical sequences ENSGGOP00000022275 ENSGGOP00000022275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]