SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022325 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022325
Domain Number 1 Region: 701-902
Classification Level Classification E-value
Superfamily Fibronectin type III 9.28e-40
Family Fibronectin type III 0.00061
Further Details:      
 
Domain Number 2 Region: 502-692
Classification Level Classification E-value
Superfamily Fibronectin type III 1.41e-34
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 3 Region: 372-467
Classification Level Classification E-value
Superfamily Fibronectin type III 2.86e-23
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 4 Region: 150-250
Classification Level Classification E-value
Superfamily Immunoglobulin 6.73e-22
Family I set domains 0.012
Further Details:      
 
Domain Number 5 Region: 1345-1433
Classification Level Classification E-value
Superfamily Immunoglobulin 3.22e-19
Family I set domains 0.018
Further Details:      
 
Domain Number 6 Region: 275-367
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000004
Family I set domains 0.03
Further Details:      
 
Domain Number 7 Region: 1129-1208
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000139
Family I set domains 0.07
Further Details:      
 
Domain Number 8 Region: 1016-1095
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000172
Family I set domains 0.073
Further Details:      
 
Domain Number 9 Region: 1250-1299
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000289
Family I set domains 0.034
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000022325
Domain Number - Region: 916-991
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00246
Family I set domains 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022325   Gene: ENSGGOG00000004080   Transcript: ENSGGOT00000029114
Sequence length 1441
Comment pep:known_by_projection chromosome:gorGor3.1:1:24870546:24927239:-1 gene:ENSGGOG00000004080 transcript:ENSGGOT00000029114 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLPHSLGGAGEPRPPQAMEVHRLEHRQEEEQKEERQHSLRMGSSVRRRTFRSRSSEEEH
EFSAADYALAAALALTASSELSWEAQLRCQTSAVELEERGQKRVGFGNDWERTEIAFLQT
HRLLRQRRDWKLLRQRTEEKVQEAKELRELCSGRGPWFWIPLRSHAVWEHTTVLLTCTVQ
ASPPPQVTWYKNDTRIDPRLFPAGKYRITNNYGLLSLEIRRCTIEDSATYTVRVKNAYGQ
ASSFAKVLVRTYLGKDAGFDSEIFKRSMFGPSVEFTSVLKPVFAREKEPFSLSCLFSEDV
LDAESIQWFRDGRLLRSSRRRKILYADRQASLKVSCTYKEDEGLYMVRVPSPFGPREQST
YVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYSIERCQGESGE
WIPCHEAPGGTCRCPIQGLVEGQSYRFRVRAISRAGSSVPSKASELVVMGDHDAARRKTE
IPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRGRAPLTYSLEK
SVIGSGTWEAISSESPVKSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGP
PATLPPPAQVQAFRDTQTSVSLTWDPVKDPELLGYYIYSRKVGTSEWQTVNNKPIQGTRF
TVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALLNCGKNEMVI
GWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAAN
WAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYTGAGPVTGYHV
SFQEEGSEQWKPVTPGPVSGTHLRVSDLQPGKSYVFQVQAVNSAGLGQPSMPTDPVLLED
KPGAHEIEVGVDEEGFIYLAFEAPEAPDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVIL
KEPGLEDLGTYSVIVTDADEDISASHTLTEEELEKLKKLSHEIRNPVIKLISGWNIDILE
RGEVRLWLEVEKLSPAAELHLIFNNKEIFSSPNRKINFEREKGLVEVIIQNLSEEDKGSY
TAQLQDGKAKNQITLTLVDDDFDKLLRKADAKRRDWKRKQGTGPYFEQPLQWKVTEDCQV
QLTCKVTNTKKETRFQWFFQRAEMSDGQYDPETGTGLLCIEELSKKDKGIYRAMVSDDRG
EDDTILDLTGDALDAIFTELGRIGALSATPLKIQGTEEGIRIFSKVKYYNVEYMKTTWFH
KDKRLESGDRIRTGTTLDEIWLHILDPKDSDKGKYTLEIAAGKEVRQLSTDLSGQAFEDA
MAEHQRLKTLAIIEKNRAKVVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVT
FLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSETGQVTISVFKHGDEPKELKS
M
Download sequence
Identical sequences ENSGGOP00000004012 ENSGGOP00000022325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]