SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022411 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022411
Domain Number 1 Region: 134-205
Classification Level Classification E-value
Superfamily RILP dimerisation region 8.24e-18
Family RILP dimerisation region 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022411   Gene: ENSGGOG00000010811   Transcript: ENSGGOT00000028618
Sequence length 211
Comment pep:known_by_projection chromosome:gorGor3.1:12:123315358:123335499:-1 gene:ENSGGOG00000010811 transcript:ENSGGOT00000028618 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LWETPRQQLRGRRGSGWPWRSPLGPEGALGKSPFQLTAEDVYDISYLLGRELMALGSDPR
VTQLQFKVVRVLEMLEALVNEGSLALEELKMERDHLRKEVEGLRRQSPPASGEVNLGPNK
MVVDLTDPNRPRFTLQELRDVLQERNKLKSQLLVVQEELQCYKSGLIPPREGPGGRREKD
AVVTRANNAGRNKEEKRIIKKLFFFRSGKQT
Download sequence
Identical sequences ENSGGOP00000024309 ENSGGOP00000022411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]