SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022469 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022469
Domain Number 1 Region: 34-136
Classification Level Classification E-value
Superfamily Immunoglobulin 6.03e-37
Family V set domains (antibody variable domain-like) 0.0000606
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022469   Gene: ENSGGOG00000024470   Transcript: ENSGGOT00000027997
Sequence length 144
Comment pep:known_by_projection chromosome:gorGor3.1:14:88061318:88062943:-1 gene:ENSGGOG00000024470 transcript:ENSGGOT00000027997 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSALRALPWLCGMPPHAWGWGLVSSALRICVLSQVQLQQSGPGLVKPSQTLSLTCAISGD
SVSSSSAAWNWIRQSPSRGLEWLGRTYYRSKWYNDYAVSVQSRITINPDTSKNQFSLQLN
SVTPEDTAVYYCARDTVRGNQCEP
Download sequence
Identical sequences ENSGGOP00000022469 ENSGGOP00000022469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]