SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022486 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022486
Domain Number 1 Region: 336-565
Classification Level Classification E-value
Superfamily Caspase-like 4.78e-39
Family Caspase catalytic domain 0.015
Further Details:      
 
Domain Number 2 Region: 28-132
Classification Level Classification E-value
Superfamily DEATH domain 3.36e-23
Family DEATH domain, DD 0.005
Further Details:      
 
Domain Number 3 Region: 129-214
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000207
Family I set domains 0.047
Further Details:      
 
Domain Number 4 Region: 226-309
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000697
Family I set domains 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022486   Gene: ENSGGOG00000023405   Transcript: ENSGGOT00000025537
Sequence length 826
Comment pep:known_by_projection chromosome:gorGor3.1:18:56659203:56743105:1 gene:ENSGGOG00000023405 transcript:ENSGGOT00000025537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLLGDPLQALPPSAAPTGPLLAPPAGATLNRLREPLLRRLSERLDQAPEGRGWRRLAEL
AGSRGRLRLSCLDLEQCSLKVLEPEGSPSLCLLKLMGEKGCTVTELSDFLQAMEHTEVLQ
LLSPPVIKKITINPESKAVLAGQFVKLCCRATGHPFVQYQWFKMNKEIPNGNTSELIFNA
VHVKDAGFYVCRVNNNFTFEFSQWSQLDVCDVPESFRRSVDGVSESKLQICVEPTSQKLM
PGSTLVLQCVAVGSPIPHYQWFKNELPLTHETKKLYMVPYVDLEHQGTYWCHVYNDRDSQ
DSKKVEIIIEGRTDEAVECTEDELNNLGHPDNKEQTTDQPLAKDKVALLIGNMNYREHPK
LKAPLVDVYELTNLLRQLDFKVVSLLDLTEYEMRNAVDEFLLLLDKGVYGLLYYAGHGYE
NFGNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRNDYDDTIPILD
ALKVTANIVFGYATCQGAEAFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDMGK
CHLTKGKQALEIRSSLSEKRALTDPIQGTEYSAESLVRNLQWAKAHELPESMCLKFDCGV
QIQLGFAAEFSNVMIIYTSIVYKPPEIIMCDAYVTDFPLDLDIDPKDANKGTPEETGSYL
VSKDLPKHCLYTRLSSLQKLKEHLVFTVCLSYQYSGLEDTVEDKQEVNVGKPLIAKLDMH
RGLGRKTCFQTCLMSNGPYQSSAATSGGAGHYHSLQDPFHGVYHSHPGNPSNVTPADSCH
CSRTPDAFISSFAHHSSCHFSRSNVPVETTDEIPFSFSDRLRISEK
Download sequence
Identical sequences ENSGGOP00000020366 ENSGGOP00000022486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]