SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022503 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022503
Domain Number 1 Region: 29-227
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-42
Family Laminin G-like module 0.0029
Further Details:      
 
Domain Number 2 Region: 478-589
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000235
Family Growth factor receptor domain 0.0077
Further Details:      
 
Domain Number 3 Region: 432-474
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000493
Family EGF-type module 0.016
Further Details:      
 
Domain Number 4 Region: 267-331
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000952
Family VWC domain 0.016
Further Details:      
 
Domain Number 5 Region: 595-637
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000166
Family EGF-type module 0.019
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000022503
Domain Number - Region: 323-395
Classification Level Classification E-value
Superfamily FnI-like domain 0.000188
Family Fibronectin type I module 0.091
Further Details:      
 
Domain Number - Region: 398-441
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0019
Family EGF-type module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022503   Gene: ENSGGOG00000007812   Transcript: ENSGGOT00000033270
Sequence length 669
Comment pep:known_by_projection chromosome:gorGor3.1:12:42319418:42679071:-1 gene:ENSGGOG00000007812 transcript:ENSGGOT00000033270 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METGLGAPLFKAWLLISVWGLGVDPCLQIDVLTELELGESTTGVRQVPGLHNGTKAFLFQ
DTPRSIKASTATAEQFFQKLRNKHEFTILVTLKQTHLNSGVILSIHHLDHRYLELESSGH
RNEVRLHYRSGSHRPHTEVFPYILADDKWHKLSLAISASHLILHIDCNKIYERVVEKPST
DLPLGTTFWLGQRNNAHGYFKGIMQDVQLLVMPQGFIAQCPDLNRTCPTCNDFHGLVQKI
MELQDILAKTSAKLSRAEQRMNRLDQCYCERTCTMKGTTYREFESWIDGCKNCTCLNGTI
QCETLICPNPDCPLKSALAYVDGKCCKECKSICQFQGQTYFEGERNTVYSSSGVCVLYEC
KDQTMKLVESSGCPALDCPESYQITLSHSCCKVCKVGYDFCSERHNCMENSVCRNLNDRA
VCSCRDGFRALREDNAYCEDIDECAEGRHYCRENTMCVNTPGSFMCICKTGYIRIDDYSC
TEHDECITNQHNCDENALCFNTVGGHNCVCKPGYTGNGTTCKAFCKDGCRNGGACIAANV
CACPQGFTGPSCETDIDECSDGFVQCDSRANCINLPGWYHCECRDGYHDNGMFSPSGESC
EDIDECGTGRHSCANDTICFNLDGGYDCRCPHGKNCTGDCIHDGKVKHNGQIWVLENDRC
SVCSCQVGI
Download sequence
Identical sequences ENSGGOP00000022503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]