SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022569 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000022569
Domain Number - Region: 248-285
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.017
Family Frizzled cysteine-rich domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022569   Gene: ENSGGOG00000006843   Transcript: ENSGGOT00000028165
Sequence length 458
Comment pep:known_by_projection chromosome:gorGor3.1:7:97679200:97686419:-1 gene:ENSGGOG00000006843 transcript:ENSGGOT00000028165 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSALRSLLLLLLPLCPGPGPGPGSEAKVTRSCAETRQVLGARGYSLNLIPPALISGEHLR
VCPQEYTCCSSETEQRLIRETEATFRGLVEDSGSFLVHTLAARHRKFDEFFLEMLSVAQH
SLTQLFSHSYGRLYAQHALIFNGLFSRLRDFYGESGEGLDDTLADFWAQLLERVFPLLHP
QYSFPPDYLLCLSRLASSTDGSLQPFGDSPRRLRLQITRTLVAARAFVQGLETGRNVVSE
ALKVPVSEGCSQALMRLIGCPLCRGVPSLMPCQGFCLNVVRGCLSSRGLEPDWGNYLGEG
IQESLLALRCCSARRYLPPVVGGSPAEQVNNPELKVDASGPDVPTRRRRLQLRAATARMK
AAALGHDLDGQDAADEDASGSGGGQQYADDWMAGAVAPPARPPRPPYPPRRDGSGGKGGG
GSARYNQGRSRSGGASIGFHTQTILILSLSALALLGPR
Download sequence
Identical sequences ENSGGOP00000022569 ENSGGOP00000006698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]