SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022655 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022655
Domain Number 1 Region: 105-203
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000297
Family I set domains 0.021
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000022655
Domain Number - Region: 29-89
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000276
Family I set domains 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022655   Gene: ENSGGOG00000006872   Transcript: ENSGGOT00000028132
Sequence length 270
Comment pep:known_by_projection chromosome:gorGor3.1:19:510569:521474:1 gene:ENSGGOG00000006872 transcript:ENSGGOT00000028132 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAALFVLLGFALLGTHGASGAAGTVLTTVEELGSKILLTCSLNDSATEVTGHRWLKGGV
VLKEDALPGQKTEFEVDSDDQWGEYSCVFLPEPMGTANIKLHHGPPRVKAVKLSEHINEG
ETAVLACKSESVPPVTDWAWYKITDSGDKALTNGSESRFFVSSSQGRSELYIENLNMEAD
PGQYRCNGTSSKGSDQAVITLRVRSHLAALWPFLGIVAEVLVLVTIIFIYEKRRKPEDVL
DDDDAGSAPLKSSGQHQNDKGKNVRQRNSS
Download sequence
Identical sequences ENSGGOP00000022655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]