SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022671 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022671
Domain Number 1 Region: 154-262
Classification Level Classification E-value
Superfamily Immunoglobulin 1.32e-16
Family I set domains 0.028
Further Details:      
 
Domain Number 2 Region: 37-119
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000105
Family Growth factor receptor domain 0.0034
Further Details:      
 
Domain Number 3 Region: 106-151
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000652
Family Ovomucoid domain III-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022671   Gene: ENSGGOG00000024287   Transcript: ENSGGOT00000023989
Sequence length 278
Comment pep:known_by_projection chromosome:gorGor3.1:9:39256884:39272371:-1 gene:ENSGGOG00000024287 transcript:ENSGGOT00000023989 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRLSLLLPLLLLLLLPLLPPLSPTFGIRDVGGRRPECGPCRPEGCPAPAPCPAPGISAL
DECGCCARRLGAEGASCGGRAGGRCGPGLVCASRAAGAAPEGTGLCVCAQRGTVCGSDGR
SYPSVCALRLRARHTPRAHPGHLHKARDGPCEFAPVVVVPPRSVHNVTGAQVGLSCEVRA
VPTPVITWRKVTKSPEGTQALEELPGDHVNIAVQVRGGPSDHEATAWILINPLRKEDEGM
YQCHAANMVGEAESHSTVMVLDLSKYRSFHFPAPDDCM
Download sequence
Identical sequences ENSGGOP00000022671 ENSGGOP00000022671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]