SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022683 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022683
Domain Number 1 Region: 15-132
Classification Level Classification E-value
Superfamily POZ domain 1.83e-29
Family BTB/POZ domain 0.0000735
Further Details:      
 
Domain Number 2 Region: 354-410
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.54e-21
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 3 Region: 395-447
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.85e-17
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 4 Region: 315-367
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.93e-16
Family Classic zinc finger, C2H2 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022683   Gene: ENSGGOG00000009787   Transcript: ENSGGOT00000025860
Sequence length 468
Comment pep:known_by_projection chromosome:gorGor3.1:17:7217320:7223903:1 gene:ENSGGOG00000009787 transcript:ENSGGOT00000025860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSPAAPEGALGYVREFTRHSSDVLGNLNELRLRGILTDVTLLVGGQPLRAHKAVLIACS
GFFYSIFRGRAGVGVDVLSLPGGPEARGFAPLLDFMYTSRLRLSPATAPAVLAAATYLQM
EHVVQACHRFIQASYEPLGISLRPLEAEPPTPPTAPPPGSPRRSEGHPDPPTESRSCSQG
PPSPASPDPKACNWKKYKYIVLNSQASQAGSLVGERSSGQPCPQARLPSGDEAEEGPIPG
PQSRLSPTAATVQFKCGAPASTPYLLTSQAQDTSGSPSERARPLPGSEFFSCQNCEAVAG
CSSGLDSLVPGDEDKPYKCQLCRSSFRYKGNLASHRTVHTGEKPYHCSICGARFNRPANL
KTHSRIHSGEKPYKCETCGSRFVQVAHLRAHVLIHTGEKPYPCPTCGTRFRHLQTLKSHV
RIHTGEKPYHCDPCGLHFRHKSQLRLHLRQKHGAATNTKVHYHILGGP
Download sequence
Identical sequences ENSGGOP00000022683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]