SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022737 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022737
Domain Number 1 Region: 42-288
Classification Level Classification E-value
Superfamily L domain-like 4.76e-47
Family Ngr ectodomain-like 0.019
Further Details:      
 
Domain Number 2 Region: 284-369
Classification Level Classification E-value
Superfamily Immunoglobulin 1.39e-16
Family I set domains 0.012
Further Details:      
 
Domain Number 3 Region: 408-478
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000285
Family Fibronectin type III 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022737   Gene: ENSGGOG00000014503   Transcript: ENSGGOT00000025476
Sequence length 573
Comment pep:known_by_projection chromosome:gorGor3.1:11:63755142:63757472:1 gene:ENSGGOG00000014503 transcript:ENSGGOT00000025476 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTRQPHLCLAVAPSSSPPWPVERPPARCCVCQNLSESLSTLCPPGLLFVPPNVDRRTVE
LRLADNFIQALGPPDFRNMTGLVDLTLSRNAITRIGARAFGDLESLRSLHLDGNRLVELG
TGSLRGPVNLQHLILSGNQLAAAPGAFDDFLESLEDLDLSYNNLRQVPWAGIGAMPALHT
LNLDHNLIDALPPGAFAQLGQLSRLDLTSNRLATLAPDPLFSGVMQRSPAPLVLSFSGNP
LHCNCELLWLRRLARPDDLETCASPPGLAGRYFWAVPEGEFSCEPPLIARHTPPLVLEGQ
RATLRCRALGDPTPTMHWVGPDDRLVGNSSRARAFPNGTLEIGVTGAGDAGGYTCIATNP
AGEATARVTAGAGLAPWWNTSPRGAAPGPRTSPSARTAARVGDAGVASRQVTEVTATSGL
VSWPGGQPTQWMFQIQYNSSEDETLIYRIVPASSHHFLLKHLVPGADYDLCLLALSPAAG
PSDLTATRLLGCAHFSTLPASPLCHALQAHVLGGTLTVAVGGVLVAALLVFTVALLVRGR
GAGNGRLPLKLSHVQSQTNGGPSPTPGPPTAEP
Download sequence
Identical sequences ENSGGOP00000022737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]