SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022767 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022767
Domain Number 1 Region: 6-435
Classification Level Classification E-value
Superfamily ALDH-like 1.14e-116
Family ALDH-like 0.00000000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022767   Gene: ENSGGOG00000015729   Transcript: ENSGGOT00000023617
Sequence length 470
Comment pep:known_by_projection chromosome:gorGor3.1:11:64585780:64597988:-1 gene:ENSGGOG00000015729 transcript:ENSGGOT00000023617 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPFEDTLRRLREAFNSGRTRPAEFRAAQLQGLGRFLQENKQLLRDMLAQDLHKPAFEAD
ISELILCQNEVDYALKNLQAWMKDEHGPRTWELRPQLDSVFIRKEPFGLVLIIAPWNYPL
NLTLVPLVGALAAGNCVVLKPSEISQGTEKVLAEVLPQYLDQSCFAMVLGGPQETGQLLQ
HKLDYIFFMGPGSPRVGKIVMTAATKYLTPVTLELGGKNPCYVDDNCDPQTMANPVAWFR
YFNAGQTCVAPDYVLCSPEMQERLLPALQSTITRFYGDNPQSSPNLGRIINQKQFQRLRA
LLGCGRVAIGGQSNESDCYIAPTVLVDVQETEPVMQEEIFRPILPIVNVQSVDEAIEFIN
RREKPLALYAFSNSSQVVNQMLERTSSGSFGGNEGFTYISLLSVPFGGVGHSGMGRYHGK
FTFDTFSHHRTCLLAPSGLEKLKEIRYPPYTDWNQQLLRWGMGSQSCTLL
Download sequence
Identical sequences ENSGGOP00000022767 ENSGGOP00000015345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]