SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022777 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022777
Domain Number 1 Region: 2-119
Classification Level Classification E-value
Superfamily POZ domain 3.93e-30
Family BTB/POZ domain 0.001
Further Details:      
 
Domain Number 2 Region: 352-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000228
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022777   Gene: ENSGGOG00000026784   Transcript: ENSGGOT00000023321
Sequence length 495
Comment pep:novel chromosome:gorGor3.1:1:33555839:33578112:1 gene:ENSGGOG00000026784 transcript:ENSGGOT00000023321 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEMQSYYAKLLGELNEQRKRDFFCDCSIIVEGRIFKAHRNILFANSGYFRALLIHYIQDS
GRHSTASLDIVTSDAFSIILDFLYSGKLDLCGENVIEVMSAASYLQMNDVVNFCKTYIRS
SLDICRKMEKEAAVAAAVAAAAAAAAAAAAAAAHQVDSESPSSGREGTSCGTKSLVSSPA
EGEKSVDCLRESPCGDCGDCHPLELVVRDSLGGGSADSDLSTPPKRIEPKVEFDADEVEV
DVGEQLQQYAAPLNLAHVEEALPSGQVVDLAYSNYHVKQFLEALLRNSAAPSKDDADHHF
PGSLEGRPEGAGVAMSSMMDVQADWYGEDSGDVLVVPIKLHKCPFCPYTAKQKGILKRHI
RSHTGERPYPCETCGKRFTRQEHLRSHALSVHRSNRPIICKGCRRTFTSHLSQGLRRFGL
CDSCTCVTDTPDDDDDLMPINLSLVEASSESQEKSDTDNDWPIYVESGEENDPAGDDSDD
KPQIQPNLSDRETLT
Download sequence
Identical sequences ENSGGOP00000022777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]