SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022786 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022786
Domain Number 1 Region: 108-170
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 7.2e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0000491
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022786   Gene: ENSGGOG00000008222   Transcript: ENSGGOT00000024001
Sequence length 320
Comment pep:known_by_projection chromosome:gorGor3.1:11:17943256:17945838:1 gene:ENSGGOG00000008222 transcript:ENSGGOT00000024001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELLSPPLRDVDLTAPDGSLCSFATTDDFYDDPCFDSPDLRFFEDLDPRLMHVGALLKPE
EHSHFPAAVHPAPGAREDEHVRAPSGHHQAGRCLLWACKACKRKTTNADRRKAATMRERR
RLSKVNEAFETLKRCTSSNPNQRLPKVEILRNAIRYIEGLQALLRDQDAAPPGAAAAFYA
PGPLPPGRGGEHYSGDSDASSPRSNCSDGMMDYSGPPSGARRRNCYEGAYYNEAPSEPRP
GKSAAVSSLDCLSSIVERISTESPAAPALLLADVPSESPPRRQEPAAPSEGESSGDPTQS
PDAAPQCPAGANPNLIYQVL
Download sequence
Identical sequences G3S3Y5
ENSGGOP00000008036 ENSGGOP00000022786 XP_004050817.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]