SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022819 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022819
Domain Number 1 Region: 366-586
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 1.83e-50
Family Galactose oxidase, central domain 0.0084
Further Details:      
 
Domain Number 2 Region: 29-145
Classification Level Classification E-value
Superfamily POZ domain 1.22e-34
Family BTB/POZ domain 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022819   Gene: ENSGGOG00000014192   Transcript: ENSGGOT00000029529
Sequence length 590
Comment pep:known_by_projection chromosome:gorGor3.1:5:121107344:121227372:-1 gene:ENSGGOG00000014192 transcript:ENSGGOT00000029529 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGESVKLSSQTLIQAGDDEKNQRTITVNPAHMGKAFKVMNELRSKQLLCDVMIVAEDVE
IEAHRVVLAACSPYFCAMFTGDMSESKAKKIEIKDVDGQTLSKLIDYIYTAEIEVTEENV
QVLLPAASLLQLMDVRQNCCDFLQSQLHPTNCLGIRAFADVHTCTDLLQQANAYAGTEQH
FPEVMLGEEFLSLSLDQVCSLISSDKLTVSSEEKVFEAVISWINYEKETRLEHMAKLMEH
VRLPLLPRDYLVQTVEEEALIKNNNTCKDFLIEAMKYHLLPLDQRLLIKNPRTKPRTPVS
LPKEVMIVVGGQAPKAIRSVECYDFEEDRWDQIAELPSRRCRAGVVFMAGHVYAVGGFNG
SLRVRTVDVYDGVKDQWTSIASMQERRSTLGAAVLNDLLYAVGGFDGSTGLASVEAYSYK
TNEWFFVAPMNTRRSSVGVGVVEGKLYAVGGYDGASRQCLSTVEQYNPATNEWIYVADMS
TRRSGAGVGVLSGQLYATGGHDGPLVRKSVEVYDPGTNTWKQVADMNMCRRNAGVCAVNG
LLYVVGGDDGSCNLASVEYYNPVTDKWTLLPTNMSTGRSYAGVAVIHKSL
Download sequence
Identical sequences ENSGGOP00000022819 ENSGGOP00000022819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]