SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022907 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022907
Domain Number 1 Region: 350-412
Classification Level Classification E-value
Superfamily BPTI-like 1.56e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0053
Further Details:      
 
Domain Number 2 Region: 225-288
Classification Level Classification E-value
Superfamily BPTI-like 1.99e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0045
Further Details:      
 
Domain Number 3 Region: 303-341
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000798
Family LDL receptor-like module 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000022907
Domain Number - Region: 198-227
Classification Level Classification E-value
Superfamily PKD domain 0.0102
Family PKD domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022907   Gene: ENSGGOG00000007202   Transcript: ENSGGOT00000027480
Sequence length 498
Comment pep:known_by_projection chromosome:gorGor3.1:15:19332149:19345391:1 gene:ENSGGOG00000007202 transcript:ENSGGOT00000027480 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PASSKVSRADQIPAVALWLLCTLGLQAELPAGADCLNRFTAGVPAFVLDTNASVSNGATF
LESPTVRRGWDCVRACCTTQNCNLALVELQPDRGEDAIAACFLINCLYEQNFVCKFAPRE
GFINYLTREVYRSYRQLRTQGFGGSGIPKAWAGIDLKVQPQEPLVLKDVENADWHLLRGD
TDVRVERKDPNQVELWGLKEGTYLFQLTVTSSDHPEDTANVTVTVLSTRQTEDYCLASNK
VGRCRGSFPRWYYDPTEQICKSFVYGGCLGNKNNYLREEECILACRGVQGPSMERRHPVC
SGTCQATQFRCSNGCCIDSFLECDDTPNCPDASDEAACEKYTSGFDELQRIHFPSDKGHC
VDLPDTGLCKESIPRWYYNPFSEHCARFTYGGCYGNKNNFEEEQQCLESCRGISKKDVFG
LRREIPIPSTGSVEMAVAVFLVICIVVVVAILGYCFFKNQRKDFHGHHHHPPPTPASSTV
STTEDTEHLVYNHTTRPL
Download sequence
Identical sequences ENSGGOP00000022907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]