SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022917 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022917
Domain Number 1 Region: 12-122
Classification Level Classification E-value
Superfamily POZ domain 3.06e-24
Family BTB/POZ domain 0.0011
Further Details:      
 
Domain Number 2 Region: 1008-1060
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.56e-17
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 1047-1103
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000043
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 4 Region: 482-534
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000547
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 5 Region: 341-389
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000223
Family Classic zinc finger, C2H2 0.057
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000022917
Domain Number - Region: 456-487
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000261
Family Classic zinc finger, C2H2 0.042
Further Details:      
 
Domain Number - Region: 1122-1152
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00635
Family Classic zinc finger, C2H2 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022917   Gene: ENSGGOG00000023008   Transcript: ENSGGOT00000030001
Sequence length 1195
Comment pep:known_by_projection chromosome:gorGor3.1:3:141643444:141694594:1 gene:ENSGGOG00000023008 transcript:ENSGGOT00000030001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVMSLSRDLKDDFHSDTVLSILNEQRIRGILCDVTIIVEDTKFKAHSNVLAASSLYFKN
IFWSHTICISSHVLELDDLKAEVFTEILNYIYSSTVVVKRQETVTDLAAAGKKLGISFLE
DLTDRNFSNSPGPYVFCITEKGVVKEEKNEKRHEEPAITNGPRITNAFSIIETENSNNMF
SPLDLRASFKKVSDSMRTASLCLERTDVCHEAEPVRTLAEHSYAVSSVAEAYRSQPVREH
DGSSPGNTGKENCEALAAKPKTCRKPKTFSIPQDSDSATENIPPPPVSNLEVNQERSPQP
AAVLTRSKSPNNEGDVHFSREDENQSSDVPGPPAAEVPPLVYNCSCCSKAFDSSTLLSAH
MQLHKPTQEPLVCKYCNKQFTTLNRLDRHEQICMRSSHMPIPGGNQRFLENYPTIGQNGG
SFTGPEPLLSENRIGEFSSTGSTLPDTDHMVKFVNGQMLYSCVVCKRSYVTLSSLRRHAN
VHSWRRTYPCHYCNKVFALAEYRTRHEIWHTGERRYQCIFCLETFMTYYILKNHQKSFHA
IDHRLSISKKTANGGLKPSVYPYKLYRLLPMKCKRAPYKSYRNSSYENARENSQMNESAP
GTYVVQNPHSSELPTLNFQDTVNTLTNSPAIPLETSACQDIPTSANVQNAEGTKWGEEAL
KIDLDNNFYSAEVSVSSTENAVSSDLRAGDVPVLSLSNSSENAASVISYSGSAPSVIVHS
SQFSSVIMHSNAIAAMTSSNHRAFSDPAVSQSLKDDSKPEPDKVGRFASRPKSIKEKKKT
TSHTRGEIPEESNYVADPGGSLSKTTNIAEETSKTETYIAKPALPGTSTNSNVAPLCQIT
VKIGNEAIVKRHILGSKLFYKRGRRPKYQMQEEPLPQGNDPEPSGDSPLGLCQSECMEMS
EVFDDASDQDSTDKPWRPYYNYKPKKKSRQLKKMRKVNWRKEHGNRSPSHKCKYPAELDC
AVGKAPQDKPFEEEETKEMPKLQCELCDGDKAVGAGNQGRPHRHLTSRPYACELCAKQFQ
SPSTLKMHMRCHTGEKPYQCKTCGRCFSVQGNLQKHERIHLGLKEFVCQYCNKAFTLNET
LKIHERIHTGEKRYHCQFCFQRFLYLSTKRNHEQRHIREHNGKGYACFQCPKICKTAAAL
GMHQKKHLFKSPSQQEKIGDMCHENSNPLENQHFIGSEDNDQKDNIQTGVENVVL
Download sequence
Identical sequences ENSGGOP00000022917 ENSGGOP00000022917 XP_004037806.1.27298 XP_004037807.1.27298 XP_004037809.1.27298 XP_004037810.1.27298 XP_018879687.1.27298 XP_018879688.1.27298 XP_018879689.1.27298 XP_018879690.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]