SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022980 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022980
Domain Number 1 Region: 160-307
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.63e-44
Family Dual specificity phosphatase-like 0.000000237
Further Details:      
 
Domain Number 2 Region: 11-149
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 5.62e-17
Family Cell cycle control phosphatase, catalytic domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022980   Gene: ENSGGOG00000011069   Transcript: ENSGGOT00000026101
Sequence length 311
Comment pep:known_by_projection chromosome:gorGor3.1:2a:93627853:93630041:-1 gene:ENSGGOG00000011069 transcript:ENSGGOT00000026101 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APVAMGLEAARELECAALGTLLREPREAERTLLLDCRPFLAFCRRHVRAARPVPWNALPP
AAVLACLLPDRALRTRLARGELARAVVLDEGSASVAELRPDGPAHVLLAALLHETRAGPT
AVYFLRGGFDGFQGCCPDLCSEAPAPALPPTGDKTSRSDPRAPVYDQGGPVEILPYLFLG
SCSHSSDLQGLQACGITAVLNVSASCPNHFEGLFRYKSIPVEDNQMVEISAWFQEAIGFI
DWVKNSGGRVLVHCQAGISRSATICLAYLMQSRRVRLDEAFDFVKQRRGVISPNFSFMGQ
LLQFETQVLCH
Download sequence
Identical sequences ENSGGOP00000022980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]