SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022985 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022985
Domain Number 1 Region: 25-112
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 1.96e-29
Family Ribosomal L11/L12e N-terminal domain 0.0000115
Further Details:      
 
Domain Number 2 Region: 101-172
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 0.0000000000000471
Family Ribosomal protein L11, C-terminal domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022985   Gene: ENSGGOG00000022054   Transcript: ENSGGOT00000032699
Sequence length 189
Comment pep:novel chromosome:gorGor3.1:1:27929612:27930504:1 gene:ENSGGOG00000022054 transcript:ENSGGOT00000032699 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAQRRPRCNFLWSSQIRVHPTPAASPVPRKFDPNEIKVIYLRCTRSEVGATSALAPKIGP
LGLSPKKVGDDIAKATDDWKGLRITVKLTSQNRQAQIEVVPSASALIIKALKEPPRDRKK
QKNIKHSGNITFDEIFNIALQHQSLAREFPGTIKEISGTAQSVGCNVDGRHPHDIIDDIN
SGAVECPAS
Download sequence
Identical sequences ENSGGOP00000022985 ENSGGOP00000022985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]