SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023043 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023043
Domain Number 1 Region: 2-95
Classification Level Classification E-value
Superfamily Immunoglobulin 6.61e-27
Family V set domains (antibody variable domain-like) 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023043   Gene: ENSGGOG00000026074   Transcript: ENSGGOT00000022579
Sequence length 98
Comment pep:known_by_projection chromosome:gorGor3.1:22:6232421:6232714:1 gene:ENSGGOG00000026074 transcript:ENSGGOT00000022579 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QTVVTQEPSLTVSPGGTVTLTCASSTGAVTSGYYPNRFQQKPGQAPRALIYSTSNKHSWT
PAGFSGSLLGGKAALTLSGAQPEDEAEYYCLLYYRGAQ
Download sequence
Identical sequences ENSGGOP00000023043 ENSGGOP00000023043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]