SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023075 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023075
Domain Number 1 Region: 1024-1163
Classification Level Classification E-value
Superfamily PRC-barrel domain 1.88e-61
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.000000174
Further Details:      
 
Domain Number 2 Region: 180-274
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000779
Family Calponin-homology domain, CH-domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023075   Gene: ENSGGOG00000002442   Transcript: ENSGGOT00000025354
Sequence length 1169
Comment pep:known_by_projection chromosome:gorGor3.1:19:7817271:7830291:1 gene:ENSGGOG00000002442 transcript:ENSGGOT00000025354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EHVPPELWEPFYTDQYAQEHVKPPVTRLLLSAELYCRAWRQALPQLETPPNPSALLTLLA
RRGTVPALPERPVREADLRHQPILMGAHLAVIDALMAAFAFEWTKTLPGPLALTSLEHKL
LFWVDTTVRRLQEKTEQEAAQRASPAAPADGAAPAQPSIRYRKDRVVARRAPCFPTVTSL
QDLASGAALAATIHCYCPQLLRLEEVCLKDPMSVADSLYNLQLVQDFCASRLPRGCPLSL
EDLLYVPPPLKVNLVVLLAELFVCFEVLKPDFVQVKDLPDGHAASPRGTEASPPQNNSGS
SSPVFTFRHPLLSSGGPQSPLRGSTGSLKSSPSMSHMEALGKAWNRQLSRPLSQAVSFST
PFGLDSDVDVVMGDPVLLRSVSSDSLGPPRPAPARTPTQPPPEPGDLPTIEEALQIIHSA
EPRLLPDGAADGSFYLHSPEGPSKPSLASPYLPEGTSKPLSDRPTKAPVYMPHPETPSKP
SPCLVGEASKPPAPSEGSPKAVASSPAATNSEVKMTSFAERKKQLVKAEAEAGAGSPTST
PAPPEALSSEMSELGARLEEKRRAIEAQKRRIEAIFAKHRQRLGKSAFLQVQPREASGEA
EAEAEADSGPVPGGERPAGEGQGEPTSRPKAVTFSPDLGPVPPEGLGEYNRAVSKLSAAL
SSLQRDMQRLTDQQQRLLAPPEAPGSAPPPAAWVIPGPTTGPKAASPSQSPRSPKHTRPA
ELRLAPLTRVLTPPHDVDSLPHLRKFSPSQVPVQTRSSILLAEETPPEEPAARPGLIEIP
LGSLADPAAEDEGDGSPAGAEDSLEEEASSEGEPRVGLGFFYKDEDKPEDEMAQKRASLL
ERQQRRAEEARRRKQWQEVEKEQRREEAARLAQEEAPGPAPPVSAVPMARADPVLLPTCL
LGKASSLIEGPPHRGAAEGRGVLGRTDSSCVPPTACWTGCCGGQGLLVGTDLHSLSPGSR
LSKIYSQSTLSLSTVANEAHNNLGVKRPTSRAPSPSGLMSPSRLPGSRERDWENGSNASS
PASVPEYTGPRLYKEPSAKSNKFIIHNALSHCCLAGKVNEPQKNRILEEIEKSKANHFLI
LFRDSSCQFRALYTLSGETEELSRLAGYGPRTVTPAMVEGIYKYNSDRKRFTQIPAKTMS
MSVDAFTIQGHLWQGKKPTTPKKGGGTPK
Download sequence
Identical sequences ENSGGOP00000002407 ENSGGOP00000023075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]