SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023083 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000023083
Domain Number - Region: 290-333
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.00615
Family Frizzled cysteine-rich domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023083   Gene: ENSGGOG00000027076   Transcript: ENSGGOT00000026194
Sequence length 478
Comment pep:known_by_projection chromosome:gorGor3.1:X:66688427:66715770:1 gene:ENSGGOG00000027076 transcript:ENSGGOT00000026194 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRGAWMWPGKDAAALTICCCCCCWAPRPSDKPCADSERAQRWRLSLASLLFFTVLLADH
LWLCAGARPRARELSSAMRPPWGAGRERQXXXXRQPVPPRAVLPLPPPPPGEPSAPPGTC
GPRYSNLTKAAPAAGSRPVCGGVPEPTGLDAACTKLQSLQRLFEPTTPAPPLRPPDSPSR
APAEFPSAKKNLLKGHFRNFTLSFCDTYTVWDLLLGMDRPDSLDCSLDTLLGDLLAVVAS
PGSGAWEACSNCIEAYQRLDRHAQEKYDEFDLVLHKYLQAEEYSIRSCTKGCKAVYKAWL
CSEYFSVTQQECQRWVPCKQYCLEVQTQCPFILPDNEEMVYGGLPGFICTGLLDTSPKHL
ETKCCDVQWVSCEAKKKKFKESEAPKTHHQQFHHSYFHHYHQQYHHYHPRHDPPGRVSNK
PALLPVSGGSRLSPSRIRLCVLVLMLLHTVVSFSSNQGGGGLGLETLPALEEGLTREE
Download sequence
Identical sequences G3S4T0
ENSGGOP00000023083 XP_004064361.1.27298 ENSGGOP00000019084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]