SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023087 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023087
Domain Number 1 Region: 131-215
Classification Level Classification E-value
Superfamily Immunoglobulin 3.82e-16
Family I set domains 0.00000656
Further Details:      
 
Domain Number 2 Region: 48-127
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000295
Family I set domains 0.0000417
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023087   Gene: ENSGGOG00000003859   Transcript: ENSGGOT00000023065
Sequence length 290
Comment pep:known_by_projection chromosome:gorGor3.1:1:140751664:140766702:1 gene:ENSGGOG00000003859 transcript:ENSGGOT00000023065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGILSFLPVLATESDWADCKSPQPWGHMLLWTAVLFLAPVAGTRAASPKAVLKLEPQWIN
VLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNDSGEYTCQTGQTSLS
DPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNF
SIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQTPSSSPMGIIVAVVTGIAVAAIVAAV
VALIYCRKKRISANPTNPDEADKVGAENTITYSLLMHPDALEEPDDQNRI
Download sequence
Identical sequences ENSGGOP00000003787 ENSGGOP00000023087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]