SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023097 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023097
Domain Number 1 Region: 20-136
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000906
Family V set domains (antibody variable domain-like) 0.016
Further Details:      
 
Domain Number 2 Region: 145-228
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000539
Family C1 set domains (antibody constant domain-like) 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023097   Gene: ENSGGOG00000012425   Transcript: ENSGGOT00000030068
Sequence length 302
Comment pep:novel chromosome:gorGor3.1:21:32878737:32892013:-1 gene:ENSGGOG00000012425 transcript:ENSGGOT00000030068 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCTCPEGSRFDLNDVYVYWQTSESK
TVVTYHIPQNSSLANVDSRYRNRALMSPAGMRRGDFSLRLFNVTPQDEQKFLCLVLSQSL
GFQEVLSVEVTLHVAANFSVPIVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLL
DQALQNDTVFLNPRGLYDVVSVLRITRTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERD
KITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETELTG
HV
Download sequence
Identical sequences ENSGGOP00000023097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]