SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023130 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023130
Domain Number 1 Region: 599-792
Classification Level Classification E-value
Superfamily Fibronectin type III 8.03e-38
Family Fibronectin type III 0.0019
Further Details:      
 
Domain Number 2 Region: 293-491
Classification Level Classification E-value
Superfamily Fibronectin type III 1.28e-37
Family Fibronectin type III 0.00078
Further Details:      
 
Domain Number 3 Region: 202-290
Classification Level Classification E-value
Superfamily Immunoglobulin 1.53e-21
Family I set domains 0.0054
Further Details:      
 
Domain Number 4 Region: 9-97
Classification Level Classification E-value
Superfamily Immunoglobulin 8.89e-17
Family I set domains 0.019
Further Details:      
 
Domain Number 5 Region: 107-199
Classification Level Classification E-value
Superfamily Immunoglobulin 1.69e-16
Family I set domains 0.027
Further Details:      
 
Domain Number 6 Region: 492-583
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000144
Family Fibronectin type III 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023130   Gene: ENSGGOG00000026231   Transcript: ENSGGOT00000034254
Sequence length 1028
Comment pep:known_by_projection chromosome:gorGor3.1:15:34672414:34738413:-1 gene:ENSGGOG00000026231 transcript:ENSGGOT00000034254 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LYLIAISAFEVQPISTEVHEGGVARFACKISSHPPAVITWEFNRTTLPMTMDRITALPTG
VLQIYDVSQRDSGNYRCIAATVAHRRKSMEASLTVIPAKESKSFHTPTIIAGPQNITTSL
HQTVVLECMATGNPKPIISWSRLEIDHKSIDVFNTRVLGNGNLMISDVRLQHAGVYVCRA
TTPGTRNFTVAMATLTVLEIAPPSFVEWPESLTRPRAGTARFVCQAEGIPSPKMSWLKNG
RKIHSNGRIKMYNSKLVINQIIPEDDAIYQCMAENSQGSILSRARLTVVMSEDRPSAPYN
VHAETMSSSAILLAWERPLYNSDKVIAYSVHYMKAEGLNNEEYQVVIGNDTTHYIIDDLE
PASNYTFYIVAYMPMGASQMSDHVTQNTLEDGLVPLRPPEISLTSRSPTDILISWLPIPA
KYRRGEVVLYRLSFRLSTENSIQVLELPGTTHEYLLEGLKPDSVYLVRITAATRVGLGES
SVWISHRTPKATSVKAPKSPELHLEPLNCTTISVRWQQDVEDTAAIQGYKLYYKEEGQQE
NGPIFLDTKDLLYTLSGLDPRRKYHVRLLAYNNIDDGYQADQTVSTPGCVSVRDRMVPPP
PPPHHLYAKANTSSSIFLHWRRPAFTAAQIINYTIRCNPVGLQNASLVLYLQTSETHMLV
QDLEPNTKYEFAVRLHVDQLSSPWSPVVYHSTLPEAPAGPPVGVKVTLIEDDTALVSWKP
PDGPETVVTRYTILYASRKAWIAGEWQVLHREGAITMALLENLVAGNVYIVKISASNEVG
EGPFSNSVELAVLPKETSESNQRPKRLDSADAKGFSGYFFELKKNQRQIHVVLVLTFLCV
LNCLSFIVQVSHFKKSSASKTAQNGAQQLPRTSASLASGNEVGKNLEGAVGNEESLMPMI
MPNSFIDAKGGTDLIINSYGPIIKNNSKKKWFFFQDSKKIQVEQPQRRFTPAVCFYQPGA
TVLISDEDSPSSPDQTTSFSRPFGVAADTEHSANSEGSHETGDSGRFSHESNDEIHLSSV
ISTTPPNL
Download sequence
Identical sequences ENSGGOP00000023130 ENSGGOP00000023130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]