SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023147 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023147
Domain Number 1 Region: 47-142
Classification Level Classification E-value
Superfamily Immunoglobulin 1.11e-18
Family I set domains 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023147   Gene: ENSGGOG00000025735   Transcript: ENSGGOT00000029278
Sequence length 409
Comment pep:novel chromosome:gorGor3.1:4:180553852:180575835:1 gene:ENSGGOG00000025735 transcript:ENSGGOT00000029278 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRLKSHLTVCFLPSVPFLILVSTLATAKSVTNSTLNGTNVVLGSVPVIIARTDHIIVKE
GNSALINCSVYGIPDPQFKWYNSIGKLLKEEEDEKERGGGKWQMHDSGLLNITKVSFSDR
GKYTCVASNIYGTVNNTVTLRVIFTSGDMGVYYMVVCLVAFTIVMVLNITRLCMMSSHLK
KTEKAINEFFRTEGAEKLQKAFEIAKRIPIITSAKTLELAKVTQFKTMEFARYIEELARS
VPLPPLIMNCRTIMEEIMEVVGLEEQGQNFVRHTPEGQEAADRDEVYTIPNSLKRSDSPA
ADSDASSLHEQPQQIAIKVSVHPQSKKEHADDQEGGQFEVKDVEETELSAEHSPETAEPS
TDVTSTELTSEEPTPVEVPDKVLPPAYLEATEPAVTHDKNTCIIYESHV
Download sequence
Identical sequences A0A2J8R353 G3SCS7 O75121
NYSGRC-IgSF-MFA3L_HUMAN ENSP00000354583 ENSGGOP00000023147 ENSGGOP00000025905 NP_067679.6.87134 NP_067679.6.92137 XP_009238725.1.23681 XP_009238726.1.23681 XP_016864357.1.92137 XP_016864358.1.92137 XP_016864359.1.92137 XP_016864360.1.92137 XP_018881274.1.27298 gi|153792329|ref|NP_067679.6| ENSP00000354583 ENSP00000377305 ENSGGOP00000023147 ENSGGOP00000025905 9606.ENSP00000354583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]