SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023168 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023168
Domain Number 1 Region: 14-118
Classification Level Classification E-value
Superfamily Kringle-like 3.87e-40
Family Kringle modules 0.0000159
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023168   Gene: ENSGGOG00000000995   Transcript: ENSGGOT00000031062
Sequence length 132
Comment pep:novel chromosome:gorGor3.1:6:161695118:161712537:-1 gene:ENSGGOG00000000995 transcript:ENSGGOT00000031062 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHKEVVLLLLLFLKSAPTETGPSVQECYHGNGQSYRGTYFTTVTGRICQAWSSMTPHQH
SRTPEKYPNDGLISNYCRNPDCSAGPWCYTTDPNVRWEYCNLTWCSDDEGTVFVPLTVIR
VPSLEDSFIQGA
Download sequence
Identical sequences ENSGGOP00000023168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]