SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023177 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000023177
Domain Number - Region: 145-224,438-543
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0102
Family Quinoprotein alcohol dehydrogenase-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023177   Gene: ENSGGOG00000011413   Transcript: ENSGGOT00000025272
Sequence length 556
Comment pep:known_by_projection chromosome:gorGor3.1:11:109980380:110020066:1 gene:ENSGGOG00000011413 transcript:ENSGGOT00000025272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FGFLCTVFKRYMGNTPQKKAVFGQCRGLPCVAPLLTTVEEAPRGISARVWGHFPKWLNGS
LLRIGPGKFEFGKDKYNHWFDGMALLHQFRMAKGTVTYRSKFLQSDTYKANSAKNRIVIS
EFGTLALPDPCKNVFERFMSRFELPGKAAAMTDNTNVNYVRYKGDYYLCTETNFMNKVDI
ETLEKTEKVDWSKFIAVNGATAHPHYDPDGTAYNMGNSYGPYGFSYKVIRVPPEKVDLGE
TIHGAQVICSIASTEKGKPSYYHSFGMTRNYIIFIEQPLKMNLWKIATSKIRGKAFSDGI
SWEPQCNTRFHVVEKRTGQLLPGRYYSKPFVTFHQINAFEDQGCVIIDLCCQDNGRTLEV
YQLQNLRKAGEGLDQSHQNNFELQDLALALELHVSLSLSQGNHLMILQFPSILRIKDADL
VIWCSHENLHQEDLEKEGGIEFPQIYYDRFSGKKYHFFYGCGFRHLVGDSLIKVDVVNKT
LKVWREDGFYPSEPVFVPAPGTNEEDGGVILSVVITPNQNENNFLLVLDAKNFEELGRAE
VPVQMPYGFHGTFIPI
Download sequence
Identical sequences ENSGGOP00000023177 ENSGGOP00000023177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]