SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023205 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023205
Domain Number 1 Region: 573-834
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.91e-91
Family Eukaryotic proteases 0.00000000342
Further Details:      
 
Domain Number 2 Region: 319-426
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-29
Family Spermadhesin, CUB domain 0.00085
Further Details:      
 
Domain Number 3 Region: 62-145
Classification Level Classification E-value
Superfamily SEA domain 0.00000000000523
Family SEA domain 0.01
Further Details:      
 
Domain Number 4 Region: 505-542
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000157
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 5 Region: 433-468
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000406
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 6 Region: 468-505
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000101
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 7 Region: 544-584
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000154
Family LDL receptor-like module 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000023205
Domain Number - Region: 270-312
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000157
Family Spermadhesin, CUB domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023205   Gene: ENSGGOG00000003188   Transcript: ENSGGOT00000034111
Sequence length 835
Comment pep:known_by_projection chromosome:gorGor3.1:11:128495397:128518611:1 gene:ENSGGOG00000003188 transcript:ENSGGOT00000034111 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQKVNGLEEDVEFLPVNNVKKVEKHGPGRWVVLAAVLIGLLLVLLGVGFLVWHLQYRDVR
VQKVFNGYMRITNENFVDAYENSNSTEFVSLASKVKDALKLLYSGVPFLGPYHKESAVTA
FSEGSVIAYYWSEFSIPQHLVEEAERVMAEERVVMLPPRARSLKSFVVTSVVAFPTDSKT
VHRTQDSTCGIPHVRVGRTSQRCCACGRKKSDYPVHSVSLPALTNEVYYDDLSKSVTLSL
RVFIRLHCLEGGDTIRMTWFLLFLMPALCPHRLCGTYPPSYNLTFHSSQNVLLITLITNT
ERRHPGFEATFFQLPKMSSCGGRLRKAQGTFNSPYYPGHYPPNIDCTWNIEVPNNQHVKV
RFKFFYLLEPGVPAGTCPKDYVEINGEKYCGERSQFVVTSNSNKITVRFHSDQSYTDTGF
LAEYLSYDSSDPCPGQFTCRTGRCIRKELRCDGWADCTDHSDELNCSCDASHQFTCKNKF
CKPLFWVCDSVNDCGDNSDEQGCSCPAQTFRCSNGKCLSKSQQCNGKDDCGDGSDEASCP
KVNVITCTKHTYRCLNGLCLSKGNPECDGKEDCSDGSDEKDCDCGLRSFTRQARVVGGTD
ADEGEWPWQVSLHALGQGHICGASLISPNWLVSAAHCYIDDRGFRYSDPTQWTAFLGLHD
QSQRSAPGVQERRLKRIISHPLFNDFTFDYDIALLELEKPAEYSSMVRPICLPDASHVFP
AGKAIWVTGWGHTQYGGTGALILQKGEIRVINQTTCENLLPQQITPRMMCVGFLSGGVDS
CQGDSGGPLSSVEADGRIFQAGVVSWGDGCAQRNKPGVYTRLPLFRDWIKENTGV
Download sequence
Identical sequences ENSGGOP00000023205 ENSGGOP00000023205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]