SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023316 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023316
Domain Number 1 Region: 138-209,256-525
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 2.36e-98
Family NadC C-terminal domain-like 0.0000141
Further Details:      
 
Domain Number 2 Region: 17-143
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 7.8e-31
Family NadC N-terminal domain-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023316   Gene: ENSGGOG00000002385   Transcript: ENSGGOT00000027072
Sequence length 528
Comment pep:known_by_projection chromosome:gorGor3.1:8:143759802:143763690:-1 gene:ENSGGOG00000002385 transcript:ENSGGOT00000027072 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FRLLASPELHLIARPKLTDLYQATMALGYEFELFFRRCPFGGAFALAAGLRDCVRFLRAF
RLRDADVQFLASVLPPDTDPAFFEHLRALDCSEVTVRALPEGSLAFPGVPLLQVSGPLLV
VQLLETPLLCLVSYASLVATNAARLRLIAGPEKRLLEMGLRRAQGPDGGLTASTYSYLGG
FDSSSNVLAGQLRGVPVAGTLAHSFVTSFSGSEVPPDPMLAPAAGEGPKVDLAAKAQVWL
EHVCAHLGLGVQEPHPGERAAFVAYALAFPRAFQGLLDSYSVWRSGLPNFLAVALALGEL
GYRAVGVRLDSGDLLQQAQEIRKAFRAAAAQFQVPWLESVLIVVSNNIDEEALARLAQEG
SEVNVIGIGTSVVTCPQQPSLGGVYKLVAVGGQPRMKLTEDPEKQTLPGSKAAFRLLGSD
GSPLMDMLQLAEEPAPKAGQELKVWPPGAQEPRTVRPAQVEPLLRLCLQQGQLCEPLPSL
AESRALAQRSLSRLSPEHRRLRSPAQYQVVLSERLQALVNSLCAGQSP
Download sequence
Identical sequences ENSGGOP00000023316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]