SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023419 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023419
Domain Number 1 Region: 80-152
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000017
Family HLH, helix-loop-helix DNA-binding domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023419   Gene: ENSGGOG00000005683   Transcript: ENSGGOT00000022469
Sequence length 389
Comment pep:known_by_projection chromosome:gorGor3.1:15:69579351:69581753:1 gene:ENSGGOG00000005683 transcript:ENSGGOT00000022469 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQSPPPQSLLGHDHYIFAQGWGWAGHWDSTSPASSSDSSGSCPCDGARGLPQPAPPSCS
SRAAEAAATTPRRARTGPAGGQRQSASEREKLRMRTLARALHELRRFLPPSLAPAGQSLT
KIETLRLAIRYIGHLSAVLGLSEESLQCRRRQRGDAGSPWGCPLCPDRGPAEAQTQAEGQ
GQGQGQGQGRGQGQGQGRRPRLVSAVLAEASWGSPSACPGAQAAPERLGRGVHDTDPWAT
PPYCPKIQSPPYSSQGTTSDASLWTPPQGCPWTQSSPEPRNPPVPWTTAPATLELAAVYQ
GLSVSPEPCLSLGAPSLLPHPSCQRLQPQTPWGCWSHSAEVVPNSEDQGPGATFQLSEAS
PAQSSGLRFSGCPELWQEDLEGARLGIFY
Download sequence
Identical sequences G3S5R3
ENSGGOP00000005560 XP_018866045.1.27298 ENSGGOP00000023419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]