SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023483 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023483
Domain Number 1 Region: 562-625
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000973
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 2 Region: 490-536
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000011
Family TSP-1 type 1 repeat 0.00077
Further Details:      
 
Domain Number 3 Region: 617-673
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000292
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 4 Region: 26-73
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000131
Family TSP-1 type 1 repeat 0.0022
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000023483
Domain Number - Region: 78-119
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000112
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number - Region: 442-480
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0103
Family EGF-type module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023483   Gene: ENSGGOG00000002197   Transcript: ENSGGOT00000023114
Sequence length 834
Comment pep:known_by_projection chromosome:gorGor3.1:17:52669159:52725871:-1 gene:ENSGGOG00000002197 transcript:ENSGGOT00000023114 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQVISLFILVGFIGEFQSFSSASSPVNCQWDSYAPWSECNGCTKTQTRRRSVAVYGQYGG
QPCVGNAFETQSCEPTRGCPTEEGCGERFRCFSGQCISKSLVCNGDSDCDEDSADEDRCE
DSERRPSCDIDKPPPNIELTGNGYNELTGQFTKRVINTKSFGGQCRRVFSGDGKDFYRLS
GNVLSYTFQVKINNDFNYEFYNSTWSYVKHTSTEHTSSSRKRSFFRSSSSSRSYTSHNNE
IHKGKVSIKYVYKALITLKSSILNDLKFLKFLMPTFPSLFQIPSSRSFSSEKILLQPWRR
QVVWSNSVLLLFIALKRNDFNSVEEKKCKSSGWHFFVKFSSHGCKELENALKAASGTQNN
VLRGDQFISGGSEGLISGLSYLELDNPAGNKRRYSAWAESVTNLPEVIKQKLTPLYELVK
EVPCASVKKLYLKWALEEYLDEFDPCHCRPCQNGGLATVEGTHCLCHCKPYTFGAACEQG
VLVGNQAGGVDGGWSCWSSWSPCVQGKKTRSRECNNPPPSGGGRSCIGETIESTQCEDEE
LEHLRLLEPHCFPLSLVPTEFCPSPPALKDGFVQDEGTMFPVGKNVVYTCNEGYSLIGNP
VARCGEDLRWLVGEMHCQKIACVLPVLMDGIQSHPQKPFYTVGEKVTVSCSGGMSLEGPS
AFLCGSSLKWSPEMKNARCVQKENLLTQAVPKCQRWEKLQNSRCVCKMPYECGPSLDVCA
RDERSKRILPLTVCKMHVLHCQGRNYTLTGRDSCTLSASAEKACGACPLWGKCDAESSKC
VCREASECEEEGFSICVEVNGKEQTMSECEAGALRCRGQSISVTSIRPCAAETQ
Download sequence
Identical sequences ENSGGOP00000023483 ENSGGOP00000023483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]