SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023577 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023577
Domain Number 1 Region: 52-135
Classification Level Classification E-value
Superfamily POZ domain 8.48e-22
Family BTB/POZ domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023577   Gene: ENSGGOG00000027584   Transcript: ENSGGOT00000022218
Sequence length 141
Comment pep:known_by_projection chromosome:gorGor3.1:17:2027319:2029174:1 gene:ENSGGOG00000027584 transcript:ENSGGOT00000022218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGEDGPAGQTDRGPGGRRAAQPRPPWIRRQPGPGLSTCPPGECAGQTMLDTMEAPGHSRQ
LLLQLNNQRTKGFLCDVIIVVQNALFRAHKNVLAASSAYLKSLVVHDNLLNLDHDMVSPA
VFRLVLDFIYTGRLADGAEAA
Download sequence
Identical sequences A0PJI1
ENSGGOP00000023577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]