SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023583 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023583
Domain Number 1 Region: 20-115
Classification Level Classification E-value
Superfamily Immunoglobulin 3.18e-30
Family V set domains (antibody variable domain-like) 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023583   Gene: ENSGGOG00000024134   Transcript: ENSGGOT00000025884
Sequence length 117
Comment pep:novel chromosome:gorGor3.1:22:6207093:6207531:1 gene:ENSGGOG00000024134 transcript:ENSGGOT00000025884 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWTPLFLFLLTCCPGSNSQAVVTQEPSLTVSPGGTVTLTCGSSTGAVTSGHYPYWFQQK
PGQAPRTLIYDTSNKHSWTPARFSGSLLGGKAALTLSGAQPEDEAEYYCWLHYSGAW
Download sequence
Identical sequences ENSGGOP00000023583 ENSGGOP00000023583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]