SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023602 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023602
Domain Number 1 Region: 38-157
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000129
Family V set domains (antibody variable domain-like) 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023602   Gene: ENSGGOG00000025096   Transcript: ENSGGOT00000029640
Sequence length 227
Comment pep:known_by_projection chromosome:gorGor3.1:1:1226928:1232492:-1 gene:ENSGGOG00000025096 transcript:ENSGGOT00000029640 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALPSRILLWKLVLLQSSAVLLHSGSSVPAAAGSSVVSESAVSWAAGARAVLRCQSPRMV
WTQDRLHDRQRVLHWDLRGPGGGPARRLLDLYSAGEQRVYEVRDRGRLELSASAFDDGNF
SLLIRAVEETDAGLYTCNLHHHYCHLYESLAVLLEVTDGKDVNLAEFAVAAGDQMLYRSE
DIQLASSLPTDYKNNILKERAELAHSPLPAKYIDLDKDPSGLCPLGA
Download sequence
Identical sequences ENSGGOP00000023602 ENSGGOP00000023602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]