SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023605 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023605
Domain Number 1 Region: 1697-1999
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.8e-101
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000301
Further Details:      
 
Domain Number 2 Region: 37-300
Classification Level Classification E-value
Superfamily Carbonic anhydrase 1.83e-75
Family Carbonic anhydrase 0.00000762
Further Details:      
 
Domain Number 3 Region: 1999-2283
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.21e-71
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000138
Further Details:      
 
Domain Number 4 Region: 309-409
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000853
Family Fibronectin type III 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023605   Gene: ENSGGOG00000023127   Transcript: ENSGGOT00000027077
Sequence length 2316
Comment pep:known_by_projection chromosome:gorGor3.1:7:119844555:120048321:1 gene:ENSGGOG00000023127 transcript:ENSGGOT00000027077 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRILKRFLACIQLLCVCRLDWANGYYRQQRKLVEEIGWSYTGALNQKNWGKKYPTCNSPK
QSPINIDEDLTQVNVNLKKLKFQGWDKTSLENTFIHNTGKTVEINLTNDYRVSGGVSEMV
FKASKITFHWGKCNMSSDGSEHSLEGQKFPLEMQIYCFDADRFSSFEEAVKGKGKLRALS
ILFEVGTEENLDFKAIIDGVESVSRFGKQAALDPFILLNLLPNSTDKYYIYNGSLTSPPC
TDTVDWIVFKDTVSISESQLAVFCEVLTMQQSGYVMLMDYLQNNFREQQYKFSRQVFSSY
TGKEEIHEAVCSSEPENVQADPENYTSLLVTWERPRVVYDTMIEKFAVLYQQLDGEDQTK
HEFLTDGYQDLGAILNNLLPNMSYVLQIVAICTNGLYGKYSDQLIVDMPTDNPELDLFPE
LIGTEEIIKEEEEGKDIEEGAIVNPGRDSATNQIRKKEPQISTTTHYNRIGTKYNEAKTN
RSPTRGSEFSGKGDVPNTSLNSTSQPVTKLATEKDISLTSQTVTELPPHTVEGTSASLND
GSKTVLRSPHMNLSGTAESLNTVSITEYEEESLLTSFKLDTGAEDSSGSSPATSAIPFIS
ENISQGYIFSSENPETITYDVLIPESARNASEDSTSSGSEESLKDPSMEGNVWFPSSTDV
TAQPDVGSGRESFLQTNYTEIRVDESEKTTKSFSTGPVMSQGPSATDLEMPHYSTFAYFP
TEVTPHAFTPSSRQQDLVSMVNVVHSQTTQPVYNGETPLQPSYSSEVFPLVTPLLLDNQI
LNTTPAASSSDSALHATPVFPSVDVSFESILSSYDGAPLLPFSSASFSSELFRHLHTVSQ
ILPQVTSATESDKVPLHASLPVAGGDLLLEPSLAQYSDVLSTTHAASETLEFGSESGVLY
KTLMFSQVEPPSSDAMMHARSSGPEPSYALSDNEGSQHIFTVSYSSAIPVHDSVGVTYQG
SLFSGPSHIPIPKSSLITPTASLLQPTHAFSGDGEWSGASSDSEFLLPDTDGLTALNISS
PVSVAEFTYTTSVFGDDNKAISKSEIIYGNETELQIPSFNEMVYPSESTVMPNMYDNVNK
LNASLQETSVSISSTKGMFLGSLAHTTTKVFDHEISQVPENNFSVQPTHTVSQASGDTSL
KPVFSANSEPASSDPASSEMLSPSTQLLFYETSASFSTEVLLQPSFQASDVDTLLKTVLP
AVPSDPILVETPKVDKISSTMLHLIVSNSASSENMLHSTSVPVFDVSPTSHMHSASLQGL
TISYASEKYEPVLFKSESSHQVVPSLYSNDELFQTANLEINQAHPPKGRHAFATPVVSID
EPLNTLINKLIHSDEILTSTKSSVTGKVFAGIPTVASDTFVSTDHSVPIGNGHVAITAVS
PNRDGSVTSTKLLFPSKATSELSHSAKSDADLVGGGEDGDTDDDDGDDDDDDRDSDGLSI
HKCMSCSSYRESQEKVMNDSDTHENSLTDQNNAILYSLSENSEEDNRVTSVSSDSQTGMD
RSPGKSPSANGLSQKHNDGKEENDIQTGSALLPLSPESKAWAVLTSDEESGSGQGTSDSL
NENETSTDFSFADTNEKDADGILAAGDSEITPGFPQSPTPSVTSENSEVFHVSEAEASNS
SHESRIGLAEGLESEKKAVIPLVIVSALTFICLVVLVGILIYWRKCFQTAHFYLEDSTSP
RVISTPPTPIFPISDDVGAIPIKHFPKHVADLHASSGFTEEFETLKEFYQEVQSCTVDLG
ITADSSNHPDNKHKNRYINIVAYDHSRVKLAQLAEKDGKLTDYINANYVDGYNRPKAYIA
AQGPLKSTAEDFWRMIWEDNVEVIVMITNLVEKGRRKCDQYWPADGSEEYGNFLVTQKSV
QVLAYYTVRNFTLRNTKIKKGSQKGRPSGRVVTQYHYTQWPDMGVPEYSLPVLTFVRKAA
YAKRHAVGPVVVHCSAGVGRTGTYIVLDSMLQQIQHEGTVNIFGFLKHIRSQRNYLVQTE
EQYVFIHDTLVEAILSKETEVLDSHIHAYVNALLIPGPAGKTKLEKQFQLLSQSNIQQSD
YSAALKQCNREKNRTSSIIPVERSRVGISSLSGEGTDYINASYIMGYYQSNEFIITQHPL
LHTIKDFWRMIWDHNAQLVVMIPDGQNMAEDEFVYWPNKDEPINCESFKVTLMAEEHKCL
SNEEKLIIQDFILEATQDDYVLEVRHFQCPKWPNPDSPISKTFELISVIKEEAANRDGPM
IVHDEHGGVTAGTFCALTTLMHQLEKENSVDVYQVAKMINLMRPGVFADIEQYQFLYKVI
LSLVSTRQEENPSTSLDSNGAALPDGNIAESLESLV
Download sequence
Identical sequences ENSGGOP00000023605 ENSGGOP00000023605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]