SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023643 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023643
Domain Number 1 Region: 225-320
Classification Level Classification E-value
Superfamily Immunoglobulin 3.81e-19
Family I set domains 0.014
Further Details:      
 
Domain Number 2 Region: 126-227
Classification Level Classification E-value
Superfamily Immunoglobulin 3.02e-16
Family C1 set domains (antibody constant domain-like) 0.062
Further Details:      
 
Domain Number 3 Region: 32-130
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000108
Family V set domains (antibody variable domain-like) 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023643   Gene: ENSGGOG00000026417   Transcript: ENSGGOT00000033686
Sequence length 400
Comment pep:known_by_projection chromosome:gorGor3.1:3:87867122:88205061:1 gene:ENSGGOG00000026417 transcript:ENSGGOT00000033686 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFVLFLCNLSLVPAAASKNKVKGSQGQFPLTQNVTVVEGGTAILTCRVDQNDNTSLQWSN
PAQQTLYFDDKKALRDNRIELVRASWHELSISVSDVSLSDEGQYTCSLFTMPVKTSKAYL
TVLGVPEKPQISGFSSPVMEGDLMQLTCKTSGSKPAADIRWFKNDKEIKDVKYLKEEDAN
RKTFTVSSTLDFRVDRSDDGVAVICRVDHESLNATPQVAMQVLEIHYTPSVKIIPSTPFP
QEGQPLILTCESKGKPLPEPVLWTKDGGELPDPDRMVVSGRELNILFLNKTDNGTYRCEA
TNTIGQSSAEYVLIVHDVPNTLLPTTIIPSLTTATVTTTVAITTSPTTSATTSSIRDPNA
LAGQNGPDHALIGGIVAVVVFVTLCSIFLLGRYLARHKGT
Download sequence
Identical sequences ENSGGOP00000023643 ENSGGOP00000023643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]