SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023646 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023646
Domain Number 1 Region: 30-105
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000188
Family Growth factor receptor domain 0.0048
Further Details:      
 
Domain Number 2 Region: 94-165
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000338
Family Fibronectin type I module 0.017
Further Details:      
 
Domain Number 3 Region: 197-241
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000275
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023646   Gene: ENSGGOG00000026479   Transcript: ENSGGOT00000034252
Sequence length 348
Comment pep:known_by_projection chromosome:gorGor3.1:6:132554701:132557693:-1 gene:ENSGGOG00000026479 transcript:ENSGGOT00000034252 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XXASVGPVRVAFVLLLALCSRPAVGQNCSGPCRCPDEPAPRCPAGVSLVLDGCGCCRVCA
KQLGELCTERDPCDPHKGLFCDFGSPANRKIGVCTAKDGAPCIFGGTVYRSGESFQSSCK
YQCTCLDGAVGCMPLCSMDVRLPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALAA
YRLEDTFGPDPTMIRANCLVQTTEWSACSKTCGMGISTRVTNDNASCRLEKQSRLCMVRP
CEADLEENIKKGKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGVCTDGRCCTPHRTTTL
PVEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA
Download sequence
Identical sequences ENSGGOP00000023646 ENSGGOP00000023646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]