SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023670 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023670
Domain Number 1 Region: 786-1101
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.08e-107
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000012
Further Details:      
 
Domain Number 2 Region: 1057-1351
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.9e-75
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000184
Further Details:      
 
Domain Number 3 Region: 296-493
Classification Level Classification E-value
Superfamily Fibronectin type III 3.71e-25
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 4 Region: 3-95
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.01e-20
Family MAM domain 0.0000402
Further Details:      
 
Domain Number 5 Region: 193-324
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000124
Family Fibronectin type III 0.007
Further Details:      
 
Domain Number 6 Region: 99-201
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000497
Family I set domains 0.0011
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000023670
Domain Number - Region: 510-622
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0765
Family Fibronectin type III 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023670   Gene: ENSGGOG00000023696   Transcript: ENSGGOT00000026198
Sequence length 1361
Comment pep:known_by_projection chromosome:gorGor3.1:6:128455597:129047682:-1 gene:ENSGGOG00000023696 transcript:ENSGGOT00000026198 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKENDTHCIDFSYLLYSQKGLNPGTLNILVRVNKGPLANPIWNVTGFTGRDWLRAELAVS
TFWPNEYQVIFEAEVSGGRSGYIAIDDIQVLSYPCDKSPHFLRLGDVEVNAGQNATFQCI
ATGRDAVHNKLWLQRRNGEDIPVAQTKNINHRRFAASFRLQEVTKTDQDLYRCVTQSERG
SGVSNFAQLIVREPPRPIAPPQLLGVGPTYLLIQLNANSIIGDGPIILKEVEYRMTSGSW
TETHAVNAPTYKLWHLDPDTEYEIRVLLTRPGEGGTGLPGPPLITRTKCAEPMRTPKTLK
IAEIQARRIAVDWESLGYNITRCHTFNVTICYHYFRGHNESKADCLDMDPKAPQHVVNHL
PPYTNVSLKMILTNPEGRKESEETIIQTDEDVPGPVPVKSLQGTSFENKIFLNWKEPLDP
NGIITQYEISYSSIRSFDPAVPVAGPPQTVSNLWNSTHHVFMHLHPGTTYQFFIRASTVK
GFGPATAINVTTNISAPTLPDYEGVDASLNETATTITVLLRPAQAKGAPISAYQIVVEEL
HPHRTKREAGAMECYQVPVTYQNAMSGGAPYYFAAELPPGNLPEPAPFTVGDNRTYQGFW
NPPLAPRKGYNIYFQAMSSVEKETKTQCVRIATKAAATEEPEVIPDPAKQTDRVVKIAGI
SAGILVFILLLLVVILIVKKSKLAKKRKDAMGNTRQEMTHMVNAMDRSYADQSTLHAEDP
LSITFMDQHNFSPRLPNDPLVPTAVLDENHSATAESSRLLDVPRYLCEGTESPYQTGQLH
PAIRVADLLQHINLMKTSDSYGFKEEYESFFEGQSASWDVAKKDQNRAKNRYGNIIAYDH
SRVILQPVEDDPSSDYINANYIDIWLYRDGYQRPSHYIATQGPVHETVYDFWRMIWQEQS
ACIVMVTNLVEVGRVKCYKYWPDDTEVYGDFKVTCVEMEPLAEYVVRTFTLERRGYNEIR
EVKQFHFTGWPDHGVPYHATGLLSFIRRVKLSNPPSAGPIVVHCSAGAGRTGCYIVIDIM
LDMAEREGVVDIYNCVKALRSRRINMVQTEEQYIFIHDAILEACLCGETAIPVCEFKAAY
FDMIRIDSQTNSSHLKDEFQTLNSVTPRLQAEDCSIACLPRNHDKNRFMDMLPPDRCLPF
LITIDGESSNYINAALMDSYRQPAAFIVTQYPLPNTVKDFWRLVYDYGCTSIVMLNEVDL
SQGCPQYWPEEGMLRYGPIQVECMSCSMDCDVINRIFRICNLTRPQEGYLMVQQFQYLGW
ASHREVPGSKRSFLKLILQVEKWQEECEEGEGRTIIHCLNGGGRSGMFCAIGIVVEMVKR
QNVVDVFHAVKTLRNSKPNMVEAPVNFVFSQGNHLKYMEKN
Download sequence
Identical sequences ENSGGOP00000023670 ENSGGOP00000023670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]