SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023756 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023756
Domain Number 1 Region: 267-351
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000138
Family V set domains (antibody variable domain-like) 0.033
Further Details:      
 
Domain Number 2 Region: 172-261
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000483
Family I set domains 0.081
Further Details:      
 
Domain Number 3 Region: 30-77,108-164
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000548
Family I set domains 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023756   Gene: ENSGGOG00000003225   Transcript: ENSGGOT00000032633
Sequence length 533
Comment pep:known_by_projection chromosome:gorGor3.1:12:6970457:6976706:1 gene:ENSGGOG00000003225 transcript:ENSGGOT00000032633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAG
VTWQHQPDSGPPAPAPGHPLVPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRV
QLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPSGSLR
TSDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWG
CILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVELPCRLPAGVGTRSFLTAKWTP
PGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIRLQEQQLNATVTLAIITVTPKSFGS
PGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEVQLLSQPWQCQLYQGERL
LGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLTLGVLSLLLLVTGAFGFHLWRRQQWR
PRRFSALEQGIHPPQAQSKIASRSQQPSPNKLPLPRKSPCPLPPQLSPPSFHP
Download sequence
Identical sequences ENSGGOP00000003170 ENSGGOP00000023756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]