SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023781 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023781
Domain Number 1 Region: 26-205
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 1.55e-83
Family MHC antigen-recognition domain 0.00000000992
Further Details:      
 
Domain Number 2 Region: 209-300
Classification Level Classification E-value
Superfamily Immunoglobulin 1.77e-31
Family C1 set domains (antibody constant domain-like) 0.0000189
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023781   Gene: ENSGGOG00000006624   Transcript: ENSGGOT00000033635
Sequence length 364
Comment pep:known_by_projection chromosome:gorGor3.1:6:32321094:32325291:-1 gene:ENSGGOG00000006624 transcript:ENSGGOT00000033635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVTAPRTLLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRF
DSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVNLRKLRGYYNQSEDGSHTLQ
SMYGCDLGPDGRLLRGYSQFAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQL
RAYLEGTCVEWLRRYLENGRETLQRADTPKTHVTHHPISDHEATLRCWALGFYPAEITLT
WQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEERYTCHVQHEGLPKPLTLRWEP
SSQSTIPIIVGIVAGLAVLVVTVAVVAVVAAVMCRRKSSGGKGGSYSQAASSDSAQGSDV
SLTA
Download sequence
Identical sequences ENSGGOP00000023781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]