SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023818 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023818
Domain Number 1 Region: 88-285
Classification Level Classification E-value
Superfamily Kelch motif 1.09e-33
Family Kelch motif 0.0025
Further Details:      
 
Domain Number 2 Region: 9-77
Classification Level Classification E-value
Superfamily POZ domain 0.00000000994
Family BTB/POZ domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023818   Gene: ENSGGOG00000023132   Transcript: ENSGGOT00000025723
Sequence length 318
Comment pep:known_by_projection chromosome:gorGor3.1:15:44351546:44352890:1 gene:ENSGGOG00000023132 transcript:ENSGGOT00000025723 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARGPQTLVQVWVGGQLFQADRALLVEHCGFFRGLFRSGMRETRAAEVRLGVLSAGGFRA
TLQVLRGDRPALAAEDVRGASKEVVELGFCYDPDGGTWREFPSPHQPRYDTALAGFDGRL
YAIGGEFQRTPISSVERYDPAAGCWSFVADLPQPAAGVPCAQACGRLFVCLWRPADTTAV
VEYAVRTDAWLPVAELRRPQSYGHCMVAHRDSLYVVRNGPSDDFLHCAIDCLNLATGQWT
ALPGQFVNSKGALFTAVVRGDTVYTVNRMFTLLYAIEGGTWRLLREKAGFPRPGSLQTFL
LRLPPGAPGPVASTTAEL
Download sequence
Identical sequences ENSGGOP00000023818 ENSGGOP00000023818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]