SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023930 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023930
Domain Number 1 Region: 153-253,421-492
Classification Level Classification E-value
Superfamily TrmE connector domain 4.18e-42
Family TrmE connector domain 0.0038
Further Details:      
 
Domain Number 2 Region: 104-184,221-411
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.54e-36
Family G proteins 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023930   Gene: ENSGGOG00000015580   Transcript: ENSGGOT00000026836
Sequence length 492
Comment pep:known_by_projection chromosome:gorGor3.1:19:17684276:17689464:1 gene:ENSGGOG00000015580 transcript:ENSGGOT00000026836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWRGLWTLAAQAARGPRRLCTRRSSGAPAPGPGATIFALSSGQGRCGIAVIRTSGPASGH
ALRILTAPRDLPLARHASLRLLSDPRSGEPLDRALVLWFPGPQSFTGEDCVEFHVHGGPA
VVSGVLQALGSVPGLRPAEAGEFTRRAFANGKLNLTEVEGLADLIHAETEAQRRQALRQL
DGELGHLCRGWAETLTKALAHVEAYIDFGEDDNLEEGVLEQADIEVRALEVALGAHLRDA
RRGQRLRSGAHVVVTGPPNAGKSSLVNLLSRKPVSIVSPEPGTTRDVLETPVDLAGFPVL
LSDTAGLREGVGPVEQEGVRRARERLEQADLILAMLDASDLASPSSCNFLATVVASVGAQ
SPSDSSQRLLLVLNKSDLLSPEGPGPGPDLPPHLLLSCLTGEGLDGLLEALRKELAAVCG
DPSTDPPLLTRARHQHHLQGCLDALGHYKQSKDLALAAEALRVARGHLTRLTGGGGTEEI
LDIIFRDFCVGK
Download sequence
Identical sequences G3S773
ENSGGOP00000023930 XP_004060301.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]