SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023967 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023967
Domain Number 1 Region: 129-368
Classification Level Classification E-value
Superfamily vWA-like 7.79e-72
Family Integrin A (or I) domain 0.00000203
Further Details:      
 
Domain Number 2 Region: 1128-1312
Classification Level Classification E-value
Superfamily Fibronectin type III 5.14e-36
Family Fibronectin type III 0.00000288
Further Details:      
 
Domain Number 3 Region: 1456-1657
Classification Level Classification E-value
Superfamily Fibronectin type III 1.69e-34
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 4 Region: 624-709
Classification Level Classification E-value
Superfamily Integrin beta tail domain 1.7e-18
Family Integrin beta tail domain 0.0024
Further Details:      
 
Domain Number 5 Region: 990-1108
Classification Level Classification E-value
Superfamily CalX-like 6.41e-18
Family CalX-beta domain 0.00089
Further Details:      
 
Domain Number 6 Region: 27-78
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000324
Family Plexin repeat 0.0018
Further Details:      
 
Domain Number 7 Region: 537-575
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000262
Family Integrin beta EGF-like domains 0.019
Further Details:      
 
Domain Number 8 Region: 579-616
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000391
Family Integrin beta EGF-like domains 0.0091
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000023967
Domain Number - Region: 507-538
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00837
Family Integrin beta EGF-like domains 0.045
Further Details:      
 
Domain Number - Region: 467-493
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0809
Family Integrin beta EGF-like domains 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023967   Gene: ENSGGOG00000009509   Transcript: ENSGGOT00000026299
Sequence length 1752
Comment pep:known_by_projection chromosome:gorGor3.1:5:7492441:7530504:-1 gene:ENSGGOG00000009509 transcript:ENSGGOT00000026299 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGPRPSPWARLLLAALISVSLSGTLANRCKKAPVKSCTECVRVDKDCAYCTDEMFRDRR
CNTQAELLAAGCQRESIVVMESSFQITEETQIDTTLRRSQMSPQGLRVRLRPGEERHFEL
EVFEPLESPVDLYILMDFSNSMSDDLDNLKKMGQNLARVLSQLTSDYTIGFGKFVDKVSV
PQTDMRPEKLKEPWPNSDPPFSFKNVISLTEDVDEFRNKLQGERISGNLDAPEGGFDAIL
QTAVCTRDIGWRPDSTHLLVFSTESAFHYEADGANVLAGIMSRNDERCHLDTTGTYTQYR
TQDYPSVPTLVRLLAKHNIIPIFAVTNYSYSYYEKLHTYFPVSSLGVLQEDSSNIVELLE
EAFNRIRSNLDIRALDSPRGLRTEVTSKMFQKTKTGSFHIRRGEVGIYQVQLRALEHVDG
THVCQLPEDQKGNIHLKPSFSDGLKMDAGIICDVCTCELQKEVRSARCSFNGDFMCGHCV
CSEGWSGQTCNCSTGSLSDIQPCLREGEDKPCSGRGECQCGHCVCYGEGRYEGQFCEYDN
FQCPRTSGFLCNDRGRCSMGQCVCEPGWTGPSCDCPLSNATCIDSNGGICNGRGHCECGR
CHCHQQSLYTDTICEINYSAIHPGLCEDLRSCVQCQAWGTGEKKGRTCEECNFKVKMVDE
LKRAEEVVVRCSFRDEDDDCTYSYTMEGDGAPGPNSTVLVHKKKDCPPGSFWWLIPLLLL
LLPLLALLLLLCWKYCACCKACLALLPCCNRGHMVGFKEDHYMLRENLMASDHLDTPMLR
SGNLKGRDVVRWKVTNNMQRPGFATHAASINPTELVPYGLSLRLARLCTENLLKPDTREC
AQLRQEVEENLNEVYRQISGVHKLQQTKFRQQPNAGKKQDHTIVDTVLMAPRSAKPALLK
LTEKQVEQRAFHDLKVAPGYYTLTADQDARGMVEFQEGVELVDVRVPLFIRPEDDDEKQL
LVEAIDVPAGTATLGRRLVNITIIKEQARDVVSFEQPEFSVSRGDQVARIPVIRRVLDGG
KSQVSYRTQDGTAQGNRNYFSAEGELLFQPGEAWKELQVKLLELQEVDSLLRGRQVRRFH
VQLSNPKFGAHLGQPHSTTIIIRDPDELDRSFTSQMLSSQPPPHGDLGAPQNPNAKAAGS
RKIHFNWLPPSGKPMGYRVKYWIQGDSESEAHLLDSKVPSVELTNLYPYCDYEMKVCAYG
AQGEGPYSSLVSCRTHQEVPSEPGRLAFNVVSSTVTQLSWAEPAETNGEITAYEVCYGLV
NDDNRPIGPMKKVLVDNPKNRMLLIENLRESQPYRYTVKARNGAGWGPEREAIINLATQP
KRPMSIPIIPDIPIVDAQSGEDYDSFLMYSDDVLRSPSGSQRPSVSDDTEHLVNGRMDFA
FPGSTNSLHRMTTTSAAAYGTHLSPHVPHRVLSTSSTLTRDYNSLTRSEHSHSTTLPRDY
STLTSVSSHDSRLTAGVPDTPTRLVFSALGPTSLRVSWQEPRCERPLQGYSVEYQLLNGG
ELHRLNIPNPAQTSVVVEDLLPNHSYVFRVRAQSQEGWGREREGVITIESQVHPQSPLCP
LPGSAFTLSTPSAPGPLVFTALSPDSLQLSWERPRRPNGDIVGYLVTCEMAQGGGPATTF
RVDGDSPESRLTVPGLSENVPYKFKVQARTTEGFGPEREGIITIESQDGGPFPQLGSHAG
LFQHPLQSEYSSITTTHTSATEPFLVDGLTLGAQHLEAGGSLTRHVTQEFVSRTLTTSGT
LSTQVDQQFFQT
Download sequence
Identical sequences ENSGGOP00000023967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]