SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023988 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023988
Domain Number 1 Region: 20-121
Classification Level Classification E-value
Superfamily Immunoglobulin 3.77e-47
Family V set domains (antibody variable domain-like) 0.0000215
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023988   Gene: ENSGGOG00000024803   Transcript: ENSGGOT00000031192
Sequence length 124
Comment pep:known_by_projection chromosome:gorGor3.1:14:88232584:88233058:-1 gene:ENSGGOG00000024803 transcript:ENSGGOT00000031192 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELGLSWVFLVAILKGVQCEVQLVESEGGLVQPGGSLRLSCAASGFTFSSYNMHWVRQAP
GKGLEWVSAIGTGGDTYYPGSVKGRFTISRENAKNSLYLQMNSLRAEDTAVYYCARDTVR
GSQY
Download sequence
Identical sequences ENSGGOP00000023988 ENSGGOP00000023988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]